AI assistant
PROSPECT RESOURCES LIMITED — Investor Presentation 2017
Sep 17, 2017
65617_rns_2017-09-17_757ea163-5ef7-4475-9ade-baf57f425b7e.pdf
Investor Presentation
Open in viewerOpens in your device viewer

Investment Outline – Arcadia Lithium Project
September 2017

Disclaimer

The information contained in this presentation or subsequently provided to any recipient of this presentation whether orally or in writing by or on behalf of Prospect Resources Ltd ("Prospect Resources or the Company") or its respective employees, agents or consultants (Information) is provided to the recipients on the terms and conditions set out in this notice. The purpose of this presentation is to provide recipients with information relating to Prospect Resources. This presentation has been prepared by Prospect Resources and each recipient must make his/her own independent assessment and investigation of Prospect Resources and its business and assets and should not rely on any statement or the adequacy and accuracy of any information.
Prospect Resources makes no representation or warranty (either expressed or implied) as to the accuracy, reliability or completeness of the Information. Prospect Resources and its directors, employees, agents and consultants shall have no liability (including liability to any person by reason of negligence or negligent misstatement) for any statements, opinions, information or matters (express or implied) arising out of, contained in or derived from, or for any omissions from the presentation, except liability under statute that can not be excluded.
This presentation contains references to certain intentions, expectations and plans of Prospect Resources. These intentions, expectations and plans may or may not be achieved. They are based on certain assumptions which may not be met or on which views may differ. The performance and operation of Prospect Resources may be influenced by a number of factors, many of which are outside the control of Prospect Resources. No representation or warranty, express or implied, is made by Prospect Resources or its respective directors, employees, officers, agents, consultants or advisers that intentions, expectations or plans will be achieved either totally or partially or that any particular rate of return will be achieved.
This presentation does not constitute in any way an offer or invitation to subscribe for securities in Prospect Resources pursuant to the Corporations Act 2001 (Cth).
Competent Person's Statements

- The information in this announcement that relates to Exploration Results, is based on information compiled by Mr Roger Tyler, a Competent Person who is a Member of The Australasian Institute of Mining and Metallurgy and The South African Institute of Mining and Metallurgy. Mr Tyler is the Company's Senior Geologist. Mr Tyler has sufficient experience relevant to the style of mineralisation and type of deposit under consideration and to the activity he is undertaking to qualify as a Competent Person as defined in the JORC Code 2012 Edition. Mr Tyler consents to the inclusion in the report of the matters based on his information in the form and context in which it appears.
- The information in this announcement that relates to Mineral Resources is based on information compiled by or under the supervision of Ms Gayle Hanssen of Digital Mining Services, Harare Zimbabwe. Ms Hanssen is registered as Professional Scientist with the South African Council for Professional Natural Scientific Professions (SACNASP) which is a Recognised Professional Organisation (RPO). Ms Hanssen is employed by DMS and has sufficient experience which is relevant to the styles of mineralisation and types of deposit under consideration and to the activity which she is undertaking to qualify as a Competent Person as defined in the JORC Code 2012 Edition. Ms Hanssen consents to the inclusion in the report of the matters based on her information in the form and context in which it appears.
- The information in this study that relates to Ore Reserves is based on information compiled by or under the supervision of Mr David Miller, a Competent Person who is a Member of The Australasian Institute of Mining and Metallurgy (MAusIMM). Mr Miller is Prospect Resources' Marketing Consultant. Mr Miller has sufficient experience relevant to the style of mineralisation and type of deposit under consideration and to the activity he is undertaking to qualify as a Competent Person as defined in the JORC Code 2012 Edition. Mr Miller consents to the inclusion in the report of the matters based on his information in the form and context in which it appears.
- The information in this study that relates to the processing plant and infrastructure design as well as the financial analysis is based on information compiled by or under the supervision of Mr Lee W John of BioMetallurgical, Zimbabwe. Mr John is registered as a Competent Person who is a Fellow of The Australasian Institute of Mining and Metallurgy (FAusIMM CP) and is Fellow with The South African Institute of Mining and Metallurgy (FSAIMM) and is registered as a Professional Engineer with the Engineering Council of South Africa (Pr. Eng. ECSA). Mr John is the Principle Engineer of BioMetallurgical and has sufficient experience which is relevant to the mineral processing project under consideration and to the activity which he is undertaking to qualify as a Competent Person as defined in the JORC Code 2012 Edition. Mr John consents to the inclusion in the report of the matters based on his information in the form and context in which it appears.
Arcadia Lithium Project Summary


Pre Feasibility Study Completed, Largest JORC Hard Rock Lithium Mineral Resource in Africa, 20 Years Life Of Mine, Skilled and Experienced Management Team, Actionable Plan to Production, Mining And Investment Approvals

Prospect Resources Background

Background
- Prospect Resources Limited (ASX:PSC) is a Southern Africa focused Lithium and Gold mining and exploration company based in Perth with operations in Zimbabwe.
- Prospect's flagship project is the Arcadia Lithium Project located on the outskirts of Harare. The Arcadia Lithium Project is one of the largest hard rock lithium resources in the world.
- Near term Spodumene and Petalite production - Prospect Resources is focused and ready to commence construction work on the Arcadia Lithium Project immediately after capital raise.
- Prospect Resources has a strong and experienced management team with a track record of building and operating mining projects in Zimbabwe
Key Management
- Hugh Warner – Executive Chairman
- Duncan (Harry) Greaves – Executive Director
- Lee John – General Manager
Detailed Profiles included in Appendix I
Market Data
| hdiSttaresousanng | 1,594,128,296 |
|---|---|
| $()klMCiiiAtttareapasaon14Set 17p | 47,823,849 |
| $h()CSiAturrenareprcec14Set 17p | 3.00 |
| hdSiitttaresoponsousanng14Set 17p | 255,000,000 |
| $()hCAasly31Ju17 | 6,100,000 |
| bDte31July17 | - |
| hhldjMSaorareoers | |
|---|---|
| hiiPNersngomnees | 3%15. |
| bBNPPiaras | %9.8 |
| lCiMBMPttapaarners | 8.9% |
| llldiiEHGtoongsroup | %8.0 |
| dlAFCitrmoreoapaux | 6.8% |
| lTtoa | 8.8%4 |
Share Price Graph YTD
Arcadia Lithium Project Location, Infrastructure and Resources

- Arcadia is conveniently located and has excellent access to infrastructure and resources:
- approximately 35 km East of Harare
- less than 20 km gravel road to sealed highway
- less than 20 km from railway to Beira, 450 km away
- less than 3 km from 33 kVA mainline power grid
- abundant groundwater available
- access to skilled and semi skilled labour from Harare – an easy daily commute from the capital city.
- All the above factors contribute significantly to the economics at Arcadia
- The mine lease area covers approximately 14km2 and located within an unpopulated agricultural area
- Mining and Environmental Approvals in place
- Surface rights secured by Prospect and being utilised for agriculture


Arcadia Lithium Project Milestones Delivered and Plan

Substantial Progress – from May 16
- Secured Option on Arcadia
- Exercised Option on Arcadia
- Undertook initial fundraising to undertake drilling and Pre Feasibility Study
- Mineral Resource Estimates further updated Aug 2017
- Environmental Impact Assessment Complete
- Pre Feasibility Study Complete
- Bulk and Grade Control Sampling initiated
- Surface rights secured – first maize crop being harvested
Next Steps
- Offtake & funding negotiations
- Funding
- Procurement
- Mine Pre Stripping and Site Works
- Construction Mineral Processing
- Commissioning and Production

| fdhSiiiiiijAALPttttgncannnouncemensrcaaumroec– | Dtae |
|---|---|
| fiiidiihijPSCALPttttacquresoponooponoverrcaaumroec | 12M2016ay |
| dhddllPSCiiiAiLiiPjiitttttexercsesoponoacqurercaaumroecanrngo2J20165commenceune | 14J2016une |
| $lPSCiA16Mitrasesnpacemen | l22J2016uy |
| llfdSCSiSPttreeasesresusocopnguy | b32061D1ecemer |
| fldSCiiiiiPMRtttannouncessgncanneraesourceesmaeupgraes | h14201M7arc |
| ldlfdiiiPSCEIAtttrecevesnvronmenaannvesmenapprovasorrcaa | 5J2017neu |
| lbldPSCPFiiiSttreeasesreeasyuy | l3J2017uy |
| dlfdllkSiiiiPCtttttteversrsproucsampesonernaonamare | l9201J17uy |
| fldPSCiiiMiRitttannouncessgncanneraesourcesesmaeupgrae | 3A2017tugus |
| blkddldSiiiiiPCAtttnaesuangraesampngarcaa | bS20417tepemer |
Target Is To Have Arcadia Lithium Mine Operational within 12 Months of Fundraising Completion
Arcadia Lithium Project Highlights

| /lKORttteyupuesus | iiDtescrpon | /lORtttesuupu |
|---|---|---|
| fALCE26,000tverageopa | lff*i%i2MR1LOCttneraesourceauo | @%i240.5M1.44LOt |
| **bblPORroaereeserve | &[email protected]%Li2O125tppm | |
| OTa25 | ||
| d75,000tonnesspomeneu | f()dlddPiIRMiRMDiGtttnvenoryanunoneouerae | %&[email protected] |
| ()6%Li2O | OTa25 | |
| l1000i55,tttonnespeae | lhhPTttanrougpu | 1200000tpa |
| ()%i2O41L | ()ffLiMiLMeoneo | 20earsy |
| ffLiMi201.2Mteoneyearsa | SiiLMWRtttoaserpao | 2.97tttwaseperonneore |
| lhhttttonnespanrougpu | ()dd%SPi6Li2OLMtpoumenerouconavg.o | 75000tpa |
| ()ldPiPi41%Li2OLMttteaerouconavg.o | 155000tpa | |
| *BddadlUpMineReEsimtetteaseonrasourcea | lhbl()iiiTLCELCELMttttoaumaronaequvaenavg.o | 26000tpa |
| blished3Au2017tpgusu | ldiiiTLMtttttanaeconanenconcenraeavg.o | lb88000spa |
| **blhelyfuhedSisd320BaPFJu17 -tseonpurrdrlldedaitote | lllldliiiMRDMS,SFttteaurgcaecoveryprasanoaon | %i271LO |
| ingunrwayuporereserve | lllldblMiRSiTteaurgcaecoveryprasanaes | 30%TOa25 |

Prospect Resources 8
Case for Arcadia Lithium Project

Arcadia Lithium Project is an attractive partner for industry / strategic and financial investors
- Last major hard rock lithium resource in the world without contractual offtake commitments
- Globally significant JORC Code compliant hard rock lithium mineral resource and largest in Africa
- Zimbabwe is the world's 5th largest lithium producer and the country has a long and established mining industry that is supported by infrastructure, relevant skillsets and resources and an accommodative legislative framework
- The following approvals are in place to commence development at Arcadia:
- Environmental approvals – Environmental Management Agency
- Licenced foreign investor – Zimbabwe Investment Authority
- Relevant mining claims owned
- Special Economic Zone application in progress
- Significant further upside in the opportunity for a lithium chemical plant (Lithium carbonate and hydroxide plant).
- Pre Feasibility Study already underway with leading global engineering firm.
- This will be the first lithium chemical plant outside of Asia and Australia.
- Geographically well placed to serve European, North American and Asian markets
- Potentially increases investment returns by an order of magnitude as a result of the significant reduction in transport and logistics costs and multiplier effect of processing on pric e
- Near term supply potential – on closing of funding, target is to have the mine in production in 12 months
- Estimated supply of more than 15-20 years
- Core team is already in place and have significant Zimbabwean mine building and operational experience
Lithium Demand has Outpaced Supply

Resulting in significant increase in lithium prices
6% Li2O Spodumene Concentrate Prices
- 2014 Greenbushes USD390/t CIF China (est)
- •2015 Greenbushes USD425/t CIF China (est)
- Current Contracts
•
- •
- •
- •
- •
Jul 17 Neometals 2017 H2 deliveries USD841/t CFR China Jul 17 Altura Mining First 3 years' production Indexed to Li2CO3
Source: GTIS - www.gtis.com
Nov 16 Galaxy Resources 120,000t for 2017 delivery USD905/t FOB Esperance Apr 17 Tawana Resources 2018 & 2019 deliveries USD880/t FOB Esperance prices min USD550/t max USD950/t
Electric Vehicles (EV) - Major Driver and Accelerating

| EU | Accelerate | French and UK authorities declared no more sales of internal combustion engines (ICE) from 2040 | |
|---|---|---|---|
| ChinaRegulationsIndia | Accelerate | NEV regulation credit can be used for corporate average fuel consumption (CAFC) regulation | |
| Accelerate | EV penetration target of 40% in 2032 | ||
| USAUS$7,500 federal EV subsidy + ZEV regulationOn track | |||
| Japan | US$100 subsidy per kWh battery | ||
| VW | Accelerate | Launching 30 EV models by 2025. Accelerating its EV plan to meet 25% of total sales in 2025. | |
| HondaToyotaProductsGM | Accelerate | China-dedicated EV will be launched in 2018 | |
| Accelerate | Set up EV division but no concrete launch schedule announced yet | ||
| On track | Bolt EV launched in December 2016 as planned | ||
| Tesla | On track | Model 3 launched in July 2017, the company is targeting 20k/month production in December | |
| Nissan | On track | Leaf full model change expected in Sep 2017 as planned | |
| All-solid-state | Accelerate | Toyota sees a 2022 launch. | |
| Battery | LiB NCA | On track | Tesla starts using 2170 type nickel-cobalt-aluminium-based (NCA) battery for Model3 as planned |
| LiB NMC | On track | Nickel rich cathode + wet separator to become the industry standard as planned |
Extracts from Goldman Sachs Report - Electric Vehicle Boom - 7 September 2017
The Lithium Market

Lithium Demand Factors Lithium Supply Factors
Demand driven by:
- The electric car boom (China expected to set end date for ICE cars)
- Falling battery prices resulting in unprecedented demand for lithiumion batteries
- Emerging energy storage market
- Traditional lithium demand markets i.e. electronics, medical, ceramics will remain supportive
- Current market players investing in more processing capacity than they have secured supply for
Near term supply constrained by:
- −Capital intensity to commercialise brine sources of lithium
- −Significant lead time for brine sources of lithium to come to production i.e. slower to respond to market conditions
Result is a significant opportunity for PSC to secure for Arcadia Lithium Project:
- •Strong offtake partners
- •Funding
- •Long term market position
Global Hard Rock Lithium Resources


Note: Hard Rock refers to all pegmatite hosted Li deposits only. Mineral Resource estimates for Projects other than Arcadia have been sourced from Company Public Domain sources. These estimates have been prepared under differing estimation methodologies and cut offs and therefore maybe not be directly comparable. Readers should therefore treat and rely on this information accordingly
Arcadia Lithium Project High Level Investment Returns Summary

| dddlUPFSMtpaeoe()lRUSDtesu | |
|---|---|
| dlMOSttoeupuummary:lPTNPV10%tttreaxeresenauea−-flIRRtttnernaaeoeurn−GLRMrosseeneovu−OPEXLMo−hflNCteasow−bkdiPPayacero− | $319M189%$23B$14B$775M2~years |
| dliiiSMAPFMtanssumponsusngoe: | |
| ()ldlklCAPEXPPFSi.iiiiiii25%tt±ere.ncngnaorngcapauw−$/()()dANSPi5ttgearermpomenerceearsvuy−$/d()(hf)iALSPttttvgongermpoumenerceereaer−$/l()()AiiNPP5ttttvgearermeaerceyears−$/()(f)lhALPiPittttttgongermeaerceereaerv− | $52.5M$788$600$524$400 |
PSC Directors have updated PFS model assumptions as a result of active engagements with various prospective offtake customers and further market information on current pricing
Dealing with Country Risk – Perception and Reality

PERCEPTIONS
Country / Civil Society Risk
- Zimbabwe is significantly more organised, developed from an infrastructure perspective and peaceful than most African countries endowed with significant mineral natural resources
- Zimbabwe has been through previous economic crises which have not resulted in widespread civil unrest
Regulatory Risk
- Zimbabwe is looking to promote and encourage investment – particularly in capital intensive mining ventures
- PSC is compliant with all local Zimbabwe laws and regulations including:
- •Zimbabwe Investment Authority Licence which includes Indigenisation approval
- • Various mining and environmental approvals to commence mining at Arcadia Lithium Project
Macroeconomic / Operating Environment
- Government of Zimbabwe is in a fiscal challenging position which is increasing local macroeconomic instability
- Priority given to export orientated businesses such as Arcadia so significant incentives are being offered .
- Various mining houses of scale continue to operate in Zimbabwe over a range of commodities
REALITIES
- Arcadia Lithium Mine will be a significant foreign currency earner for Zimbabwe which is extremely important to the country and is actively engaging with Central Bank on various requirements for project
- Various members of the Management Team have been through previous economic crises in Zimbabwe and have financial, legal and managerial experience to deal with economic challenges in the Zimbabwean context
- The Arcadia Lithium Project can survive as an "island" if required:
- Power can be generated off grid and the project remains financially profitable
- Markets based on international offtake agreements thus not affected by local economic fundamentals thus value created underpinned by an international currency i.e the USD
- The project will be a significant foreign currency earner and can thus sustain its operations in isolation to the wider economy
- Zimbabwe's current fiscal and monetary policy approach is not sustainable over the long term and the Country needs to increase materially export earnings – exactly what Arcadia Project seeks to achieve
- Prospect Resources has partnered locals as shareholders in the Arcadia Lithium Mine Project

APPENDIX I
Profiles of Board Members, Key Management and Consultants
Profiles – Board Members

Prospect Resources board of directors, management and technical consultants have extensive experience and demonstrated capacities in the commercialisation of mineral ores in Zimbabwe and across Africa.
| hHWugarner()ihiECtxecuvearman | hldhlffhflhbdblMWBEiUiiWAiHiittttrarnerosaaceoroconomcsromenversyoesernusraa.easroaexperenceasapucdhbdfbfbllldldhldiiiiiiiiiiittttcompanyrecor,avngeenarecoroanumeropucysecompanesnvovenemnng,oangas,bhlddiiiittoecnoogyanservcenusres. |
|---|---|
| ()DHGuncanarryreaves()iiEDttxecuverecor | ()().hldlfflhfhfdhhldfMGB.SAiUiiNiSAiHiiFitttttrreavesosacgrcuureromnversyoaanourcaeseounngsareoeroarvcldd()dhhhlfdldhbbCiMiPLiPiOFiiiZiMGttttttonsoaenesvwcoperaesernceaanarvcgomnesnsouernmawe.rreavesllddllkbfhbbfiZiiiittttsawerespeceanwenownmemeroemawemnngraerny. |
| hGFerryaey(iNEtonxecuve)iDtrecor | hhbhhldllldl3iiiiiiiiiiiiMF5Httttttraeyasoveryearsexperencenoenernaonaanocamnerasnusry.esaspecasnmnngldlddkdfhflflldhhiii0CiGiiiG1MDttttgeoogy,mneeveopmenanrannganworeoryearsaseeoogsnngoreaowereewasffilildihhdlhkhklbdhildidhlliECGPttttttacveynvoveweeveopmenoeurea,aa,oeanoenxgomnesaneoownglldllldhdllbAijKBGFSiWtttsraangoproecsanonaee,oeneaer,nrseanaau:wuy. |
|---|---|
| dikZReuse(iNEtonxecuve)iDtrecor | fffikiliidilhiiidildhbbiMRHMDUBMtt.ttttrsesaqaeacconaneaspreoseanagngrecoroneersercaneoreenguuuwvuyudfdldd,ldhbbkGMiDiRHiLiiZiStttttttpromoeoropanagngrecororaarongsmeaargeqoecompanonemaeocuuywhkfdfdhfhbdfhfdfbbEMRiiPiCiCiZitttttxcange.rusesaormerresenoancurrenarmanoeoaroeoneeraonomawedIitnusres. |
| ijiQYngaou(iNEtonecexuv)iDtrecor | hfffhhbdhdllkfbkMYiiiLii-iiiCiiittttttrasoereenearsoeperencenemonaernsrnnaansenonorengaeuvyxuyuywwyfhhbhllhdfdhiiCiCMYiCiCEOEFiNCitttttttgurenenaaeryecnoogysecor.urreny,rusarmananonergynanceeannalhdfhhlf(hlBNHiPiCiBMiS-GABECBBSLiiiittt.tttttttttaeryeesasoeresenorenaaeryagazne,ecrearyeneraorumeecrcy"D")dlfhdhllliDiZBITIiAitttttttavoscommeeanasoarecoroongguancunaerynusryecnoogynnovaonance. |
| hlhlMNananaana(NEitonxecuve)iDtrecor | ()hlhlhfd,hfdld,fMNiCiMiLiiAFCiPLPtttttttsanasarpersonoonmeeparencompanormoreoapaoneorospecyuxyhhlddblkdhfbddfdRjMiLiii100%SAiiiiittttesourcesmaorsareoers.onmesaacowneourcanaseversenvesmencompany. |
Profiles – Key Management

| hlbdCiHirsrans()GCOFroup | lbdhkdfbfblldhdliCOiiiSiiMHFAXAIMttrransasworeasoranumeropuccompanesseoneanprmaryresources,flbhbblfhflhhd.ididdiiddiiiiiMHttttttttocuserransaseenresponseoreayoaynancaanamnsraveoperaonsogeerwfhidlibliihiiilbdhdihdMHB.CCtttttttttesaorreporngancompanceogaonsoeseorganaons.rransasaomansaarereuyzAtt.onanccu |
|---|---|
| hLJeeon(lGMeneraanaergi)Otperaons | hlhh'sdlMJiMiPiEiH25iiiiiitronsanerasrocessngngneer.easmoreanyearexperencenmnnganmnerasprocessngdhlld'sfld18iiiCOO,CEOLAiiiiiitttanmoreanyearsnmanagemenroes,ncungeercanexperencencuesoperangmnngh(),bbdbbjiiCDRCMiZiBKTiZitttproecswnongoozamque,ama,oswana,enya,anzanaanmawe. |
| lRToerergy(hifli)CGteeoogs | lhlhflkfhlfMTiBiii30iiiAiiTiDitt,tttrersarsgeoogsoaeramosearsorngeperencenrca,snoecncarecororywywxwhdlfhlhlfdfFiHHiMiiGRSMiMEiiittarvc.easanonoursegreennngeoogyromeoyacooonesanaaserongneerngnlfdkdflfMiREiiWiUiiR15iiiAittttttneraesourcesmaonromwaersrannversy.ogerworeoryearsasageoogsnvarousrcandllfllhhliSiRAAAiCiMAittttttcounresanaerasaenoresourcenaysorngomercanorporaon.osrecenyowever,ewasnv'sldldhhhldhdlfhMiiDRCiiiKiittttttnngexporaonmanageraneeprogrammewcresueneeveopmenoenseveremne.hhldldddiiiCiiHFMPRttesasareoernarvconsoaenesanrospecesources. |
| ihGStanepensv()fiACFOrac | hdhd(bb)hdlMSiiCAZii1991.HFiiDiIMFtttttttrepenssaregserearereccounanmawesnceeasserveasnancarecorold()ddbb(d),hfllhlfHiPLPPCZiLiBiDDitttttttongsvanmaweneaccaseorenyears,asweaseusnesseveopmenrecororbbdffhfhldhldldCiiiiiiiijPPZLIttttttttmaweoraurerveyears.nscapacyswasnvovewexporaon,proeceveopmenanfkllldlkdllhfliiiiiiiiiHttttttnance.sssencuessraegcpannng,rsmanagemenancorporaegovernance,asweasenancalkllhfhbbdiidiiii25Zttttangeneramanagemenssassocaewyearsoexperencenemaweeconomy. |
| ikiMKteney(lli)Mtteaurgs | llhhlfiiiiii6iiiiii&MKM4RD,ttttttrneysapracsngeaurgswoveryearswexperencenmneraprocessngrangngromlllddlldijiiiiiiiAMtt.ttttoperaonsmanagemensoaeyproecesgn,consruconancommssonng.nerasexposurencueslhhllhhlhfid,idiiiiiiidIMKtttttttaumna,pospae,gocopper,nanumneaercaserneyasspeccexperencenspoumenebfddlhblddlhldiiiiiiiiiiHMStttttttenecaonanonsreammcaronaepanesgn,consrconancommssonng.easoosancwuudliMiEiegreenneraconomcs. |
Profiles –Technical Consultants

| ikMVteener()liliCGttonsungeoogs | llhhhdbdhiiii23iiiMVHtttttttrenersaconsunggeoogswmoreanyearsexperence.easgeneraearoaexperenceneiidliidjilidliihlldilHtttttttttmnnganexporaonnusryaacorporae,unorexporaonanconsungcapacy.easraveeexensvey,khhbhdfl,ddkhiijSSWAiBiCEAiMittttorngonarosproecsrogoaarananesrca,raanaa,ropeansa.easawvuuuuzu()ldllfhBSHiGiFSEGtconsneoogyansaeowoe |
|---|---|
| dlliiDMaver()iiiMEnngngneer | 'illiiiiihiihilidhlhhMM33Ittttttrersamnngengneerwyearsexperencenemneraresourcenusry.neasenyearseashldbfbdllldhdlddkiiiiiittt,tttenanmerosenorsnesseeopmenroesncngeassessmeneeopmenanprocmarenguuvuvuflhdliiijtttttoumnananaumproecs., |

APPENDIX II
High Level Analysis Hardrock Lithium Resources vs Market Capitalisation
Global Hard Rock Lithium Resources


- Arcadia contains over 1.85 Mt of Lithium Carbonate Equivalent (LCE)
- Appears undervalued when compared to its peers, as shown by market capitalisation.
Note: LCE estimates for Projects other than Arcadia have been sourced from Company Public Domain sources. These estimates have been prepared under differing estimation methodologies and cut offs and therefore maybe not be directly comparable. Readers should therefore treat and rely on this information accordingly Market Cap data as of 14 Sep 2017

APPENDIX III
Arcadia Mineral Ore Reserve & Resources Estimation
Arcadia Ore Reserve Estimates

| Ctaegory | Tonnes(M)t | i2OL(%) | TOa25 ()ppm | i2OL()t | TOa25 Mlbs | OFe23(%) |
|---|---|---|---|---|---|---|
| Proven | 0 | 0 | 0 | 0 | 0 | 0 |
| bblProae | 185. | 1.34 | 125 | 212,000 | 34. | 1.02 |
| OTTAL | 185. | 1.34 | 125 | 212,000 | 34. | 1.02 |
Arcadia Lithium Deposit Ore Reserve Estimate (>1% Li2O)*
- • Ore Reserve represents the first 15 years of production
- • Contains 525,000 tonnes of Lithium Carbonate Equivalent (LCE)
- • Ore Reserve estimates currently being updated and optimised

Arcadia Mineral Resource Estimates

| ihdi2ffHGZ1%LOC*t-graeoneou- | ||||||
|---|---|---|---|---|---|---|
| Ctaegory | TonnesMt | i2O%L | TOa25 ppm | i2LOTonnes | TOa25 Mlbs | |
| dMeasure | 6.2 | 1.48% | 132 | 92,400 | 1.8 | |
| ddiItncae | 22.3 | 1.36% | 117 | 303,007 | 85. | |
| fdInerre | 12.0 | 1.6%5 | 117 | 186,600 | 3.0 | |
| GRANDOTTAL | 40.5 | 1.44% | 119 | 582,700 | 10.6 |
| lbli2ffGR0.2%LOC*t-oaesourceuo- | ||||||
|---|---|---|---|---|---|---|
| Ctaegory | TonnesMt | i2LO% | TOa25 ppm | i2LOTonnes | TOa25 Mlbs | |
| dMeasure | 10.2 | 1.16% | 134 | 11007,7 | 2.8 | |
| didItncae | 387. | 1.07% | 118 | 060044, | 9.4 | |
| fdInerre | 18.6 | 1.25% | 109 | 232,700 | 5.0 | |
| GRANDTOTAL | 66.6 | 1.13% | 117 | 000755, | 127. |
*As described in ASX Announcement 3 August 2017
Over 1,850,000 tonnes of Lithium Carbonate Equivalent (LCE)



APPENDIX IV
Arcadia Lithium Mine – Processing and Logistics
Arcadia Lithium Project - Processing & Logistics

- Extensive metallurgical testwork completed
- Total recoveries 71%, process optimisation continues
- Simple open pit, and short haul to communition and process plant
- Sufficient ground and surface water with grid power <3km away



For further information, please contact
Hugh Warner
Prospect Resources Executive ChairmanMobile: +61 413621652

Harry Greaves
Prospect Resources Executive Director Mobile:+263 772144669