Skip to main content

AI assistant

Sign in to chat with this filing

The assistant answers questions, extracts KPIs, and summarises risk factors directly from the filing text.

AAK Annual Report 2016

Apr 19, 2017

2874_10-k_2017-04-19_6d9b1612-660f-4933-b9f1-7721b4ec6e36.pdf

Annual Report

Open in viewer

Opens in your device viewer

{# SEO P0-1: filing HTML is rendered server-side so Googlebot sees the full text without executing JS or following an iframe to a Disallow'd CDN path. The content has already been sanitized through filings.seo.sanitize_filing_html. #}

AAK Annual Report 2016

*7KH&R'HYHORSPHQW&RPSDQ*

AAK in 60 seconds

We develop and provide value-adding vegetable oil solutions in close collaboration with our customers, enabling them to achieve long-lasting business results.

We do so through our in-depth expertise in oils & fats within food applications, working with a wide range of raw materials and broad process capabilities.

Through our unique co-development approach we bring together our customers' skills and know-how with our capa-ELOLWLHVDQGPLQGVHW%\GRLQJVRZHVROYHFXVWRPHUVSHFL¿F needs across many industries – Bakery, Chocolate & Confectionery, Dairy, Foodservice, Special Nutrition, Personal Care, and more.

AAK's proven expertise is based on more than 140 years of experience within oils & fats. With our headquarters in Malmö, Sweden, 20 production facilities and customization SODQWVDQGVDOHVRI¿FHVLQPRUHWKDQFRXQWULHVRXU nearly 3,000 employees are dedicated to providing innovative value-adding solutions to our customers.

So no matter where you are in the world, we are ready to help you achieve long-lasting results.

We are AAK – The Co-Development Company.

Three business areas

Food Ingredients

Our largest business area primarily offers solutions to the bakery, dairy, foodservice and special nutrition industries. The latter includes solutions within infant, senior and medical nutrition.

Chocolate & Confectionery Fats

Our second largest business area offers functional cocoa butter alternatives for chocolate, FRPSRXQGVIRUFRDWLQJDQGPRXOGLQJDQGVSHFLDOLW\IDWVIRUFRQIHFWLRQHU\¿OOLQJV

Technical Products & Feed

Our Technical Products & Feed business area offers fatty acids and glycerine for various applications, and proteins and fats for animal feed.

Medium- and fast-growing markets

Slow-growing markets

  • Nordics - Western Europe
  • * Management ambition

  • Fast-growing markets - Asia

  • Latin America
  • Medium-growing markets
  • USA
  • CEE
  • CIS
Operational key figures
(SEK million unless otherwise stated)
2012 2013 2014 2015
Net sales 16,911 16,537 17,814 20,114
Adjusted operating profit (EBIT)* 1,003 1,127 1,242 1,411
Operating profit 975 1,117 1,262 1,409
Operating profit per kilo, SEK 0.66 0.69 0.74 0.77
Cash flow from operating activities 1,539 1,300 692 1,736
Earnings per share, SEK 15.66 17.87 21.15 22.17
Equity per share, SEK 95.32 105.76 138.51 156.77
Dividend per share, SEK 5.25 6.00 6.75 7.75
Return on capital employed, % 14.2 16.4 16.0 15.7
Return on equity, % 17.6 18.5 18.0 15.1

* Adjusted for non-recurring items and acquisition costs. ** In accordance with the Board of Directors' proposal. 'H¿QLWLRQVVHHSDJHRIWKH\$\$.\$QQXDO5HSRUW

AAK in the world

2016 in brief

  • Total volumes were up 7 percent (8) and organic volume growth was up 2 percent (3).
  • Net sales amounted to SEK 22,057 million (20,114). The increase was mainly due to the positive product mix, increased raw material prices, and acquisitions, partly offset by a negative currency translation impact of SEK 648 million.
  • 2SHUDWLQJSUR¿WH[FOXGLQJQRQUHFXUULQJLWHPVUHDFKHG SEK 1,615 million (1,411), an improvement of 14 percent. 2SHUDWLQJSUR¿WDW¿[HGIRUHLJQH[FKDQJHUDWHVDQG excluding non-recurring items, improved by 17 percent.
  • 2SHUDWLQJSUR¿WLQFOXGLQJQRQUHFXUULQJLWHPVRSHUDWLQJ SUR¿WUHDFKHG6(.PLOOLRQ?DQLPSURYHPHQW of 15 percent.
  • The largest business area, Food Ingredients, reported DQRSHUDWLQJSUR¿WRI6(.PLOOLRQ?DQLPSURYH PHQWRISHUFHQW2SHUDWLQJSUR¿WSHUNLORLQFUHDVHGE\ 4 percent to SEK 0.75 (0.72).

  • The business area Chocolate & Confectionery Fats UHSRUWHGDQRSHUDWLQJSUR¿WRI6(.PLOOLRQ? DQLPSURYHPHQWRISHUFHQW2SHUDWLQJSUR¿WSHUNLOR increased by 2 percent, to SEK 1.81 (1.77).

  • The smallest business area, Technical Products & Feed, UHSRUWHGDQLQFUHDVHGRSHUDWLQJSUR¿WDW6(.PLOOLRQ ?2SHUDWLQJSUR¿WSHUNLORLQFUHDVHGE\SHUFHQWWR SEK 0.36 (0.33).
  • 2SHUDWLQJFDVKÀRZLQFOXGLQJFKDQJHVLQZRUNLQJFDSLWDO DPRXQWHGWR6(.PLOOLRQ?&DVKÀRZIURP working capital was negative, amounting to SEK 263 million (positive 380). This was due to the impact from substantially increased raw material prices during the last quarters, combined with working capital tied up for the WZRJUHHQ¿HOGLQYHVWPHQWV
  • Earnings per share increased by 7 percent, to SEK 23.71 (22.17).
  • Return on Capital Employed (ROCE), calculated on a rolling 12 months basis, was 15.8 percent (15.7) despite negative effect of higher working capital due to LQFUHDVHGUDZPDWHULDOSULFHVJUHHQ¿HOGLQYHVWPHQWV and acquisitions.

  • Our new speciality and semi-speciality edible oils factory LQ-XQGLDt%UD]LOZDVRI¿FLDOO\LQDXJXUDWHGLQ-XQH:LWK the new plant in operation, we have taken a major step forward in our global growth strategy and it brings us closer to our customers in yet another key market. The fully automated, multi-oil and multi-process plant has an initial production capacity of 100,000 MT per year, and opens up many new possibilities for our customers in Brazil in a wide range of applications.

  • In July, we acquired the leading US West Coast based vegetable oils company California Oils Corporation, also known as CalOils, from Mitsubishi Corporation of Japan. In 2015, CalOils had revenues of approximately SEK 1,350 million and a volume of approximately 110,000 MT. The acquisition establishes AAK as the leading supplier of speciality and semi-speciality oils to the bakery, dairy and chocolate and confectionery industries in California and across the west coast of the US and Canada.
  • Our very similar speciality and semi-speciality edible oils factory in Zhangjiagang, China was completed at the HQGRIDQGWKH¿UVWYROXPHVZHUHGHOLYHUHGLQHDUO\ 2017. Fully utilized, the plant will increase AAK's total capacity by approximately 100,000 MT, with room for further expansion at a later stage.
  • Having successfully completed our three years with AAKtion, we launched our new company program, The AAK Way, in January 2017. The AAK Way, which will JXLGHXVXSWKURXJKZLOOIRFXVRQWKHIROORZLQJ¿YH priority areas: Go to Market, Operational Excellence, Special Focus Areas, Innovation, and People.
  • Our strong and continued commitment to responsible growth was outlined in our annual Sustainability Report, documenting our activities, achievements and future objectives.
  • René Schou was in June 2016 appointed President Foodservice Europe and is a member of the AAK Executive Committee.

AAK Group

(SEK million unless otherwise stated) 2012 2013 2014 2015 2016
Volumes, thousand tonnes 1,511 1,620 1,703 1,833 1,966
Adjusted operating profit (EBIT)* 1,003 1,127 1,242 1,411 1,615
Earnings per share, SEK 15.66 17.87 21.15 22.17 23.71
Net sales 16.911 16.537 17.814 20.114 22.057

*Adjusted for non-recurring items and acquisition costs

Comments by Melker Schörling, Chairman of the Board 3
Comments by Arne Frank, CEO 4
AAK's vision 6
The AAK Way 7
The business model – global provider of
value-adding solutions 8
Business Area Food Ingredients 12
Business Area Chocolate & Confectionery Fats 14
Business Area Technical Products & Feed 18
Regional markets 20
Risks 22
Employees 24
Sustainable growth 26
Comments by Fredrik Nilsson, CFO 28
Reasons to invest in AAK 29
Board of Directors 30
Executive Committee 32
AAK Glossary 34
Directors' Report 37
Consolidated Income Statement 41
Consolidated Statement of Comprehensive Income 41
Consolidated Balance Sheet 42
Consolidated Changes in Shareholders' Equity 44
Consolidated Cash Flow Statement 45
Income Statement – Parent Company 46
Statement of Comprehensive Income – Parent Company 46
Balance Sheet – Parent Company 47
Changes in Shareholders' Equity – Parent Company 48
Cash Flow Statement – Parent Company 49
Notes 50
Alternative Performance Measures 77
Corporate Governance Report 79
Auditor's report 85
The AAK share 88
'H¿QLWLRQV 90
Financial Calendar, Annual General Meeting 91

Contents

Looking back on yet another inspiring year as Chairman of the Board of AAK, it is with great satisfaction I announce that the company continues to grow – organically and through acquisitions – and to demonstrate its strengths and customer EHQH¿WVZLWKLQWKHZRUOGRIYHJHWDEOHRLOV

During the past year AAK has, in close collaboration ZLWKLWVFXVWRPHUVFRQWLQXHGWRGHYHORSLQQRYDWLYHDQG FXVWRPL]HGYHJHWDEOHRLOVVROXWLRQVWKDWPHHWVSHFL¿F FXVWRPHUQHHGV7KHGHYHORSPHQWRIVXFKVSHFLDOLW\DQG semi-speciality solutions is really the core of AAK's expertise, EXLOWXSGXULQJWKHFRPSDQ\¶V\HDUORQJKLVWRU\

7KHSURVSHFWVIRUWKHIXWXUHFRQWLQXHWRORRNJRRGDQG WKHSURJUHVVPDGHRYHUWKHSDVWWZHOYHPRQWKVLVVWURQJ HYLGHQFHWKDWWKHVWUDWHJLFGLUHFWLRQ\$\$.KDVFKRVHQ FHUWDLQO\LVWKHULJKWRQHWRIROORZ

AAKtion and new company program

7KHHQGRIDOVRPDUNHGWKHHQGRI\$\$.WLRQWKH FRPSDQ\SURJUDPWKDWKDVJXLGHG\$\$.RYHUWKHODVWWKUHH \HDUV\$FHQWUDOSDUWRI\$\$.WLRQZDVWRLQYHVWDQGH[SDQG LQIDVWJURZLQJPDUNHWV7KHUHIRUHLWKDVEHHQDJUHDWSOHD sure to witness the completion of the company's two new VSHFLDOLW\DQGVHPLVSHFLDOLW\IDFWRULHVLQ%UD]LODQG&KLQD

,QDGGLWLRQWRWKHVHVWUDWHJLFJUHHQ¿HOGSURMHFWV\$\$.KDV during the year expanded its footprint in the United States ZLWKDYHU\LQWHUHVWLQJDFTXLVLWLRQLQ&DOLIRUQLDJLYLQJWKH company a nationwide presence in the important American PDUNHW

7KH\HDUVDZVRPHYHU\JRRGGHYHORSPHQWVZLWKLQ\$\$.¶V SDOPRLOVXVWDLQDELOLW\FRPPLWPHQWVDQGLPSRUWDQWLPSURYH - PHQWVZHUHDOVRPDGHZLWKLQUHVRXUFHHI¿FLHQF\DQGZRUN - SODFHVDIHW)XUWKHUPRUH\$\$.¶VSHUVLVWHQWZRUNLQ:HVW \$IULFDWRZDUGVDPRUHVXVWDLQDEOHDQGHI¿FLHQWVXSSO\FKDLQ KDVFRQWLQXHGWREHQH¿WKXQGUHGVRIWKRXVDQGVRIORFDO ZRPHQFROOHFWLQJVKHDNHUQHOV\$\$.ZLOORIFRXUVHPDLQWDLQ this strong CSR focus as the company continues along the SDWKRIEXVLQHVVJURZWK

By adding these new platforms for production and increased sales, AAK has reinforced its position as a global PDUNHWOHDGHUZLWKLQVSHFLDOLW\YHJHWDEOHRLOVVROXWLRQV 7RJXLGH\$\$.LQLWVHIIRUWVJRLQJIRUZDUGDQHZFRPSDQ\ SURJUDP7KH\$\$.:D\ZDVODXQFKHGLQ-DQXDU\ Building on the strong foundation that AAKtion has created, combined with new focus areas such as Senior Nutrition, 0HGLFDO1XWULWLRQDQG3ODQWEDVHGGDLU\7KH\$\$.:D\ZLOO OHDGWKHFRPSDQ\XSWKURXJK p g JHWDEOHRLOVVR OXW LRQV RUZDUGDQHZFRPSDQ\ QFKHGLQ-DQXDU\uch Nutrition, G GDLU\7KH\$\$. :D\ZLOO \HDUV,WZDVg

Continued engagement

Strong sustainability commitment t

\$V\RXDOOSUREDEO\NQRZZLOOEHP\ODVWIXOO\HDU DV&KDLUPDQRIWKH%RDUGRI\$\$.1HYHUWKHOHVV\$\$.ZLOO continue to be a core holding of Melker Schörling AB, which demonstrates that our engagement, commitment and belief LQWKHORQJWHUPSHUVSHFWLYHRIWKHFRPSDQ\ZLOOUHPDLQ XQFKDQJHG

7KHSXEOLFGHPDQGIRUDPRUHVXVWDLQDEOHZRUOGKDV VLJQL¿FDQWO\LQFUHDVHGRYHUWKHODVW\HDUVDQGVXVWDLQDELOLW\ KDVIRUPDQ\FRPSDQLHVEHFRPHDFULWLFDOEXVLQHVVDFWLYLW\ 7KLVKDVEHHQWKHFDVHIRU\$\$.IRUPDQ\HDUV,WZDV tremendously encouraging to see that trend continue GXULQJ VWDLQDEOHZRUOGKDV VW\HDUVDQGVXVWDLQDELOLW\DFULWLFDOEXVLQHVV DFW L Y L W \ RUPDQ \

+DYLQJGHYHORSHGLQWRDWUXO\JOREDOPDUNHWOHDGHULQ its industry, it is with a strong sense of pride and optimism WKDW,ORRNXSRQ\$\$.¶VFRQWLQXLQJJURZWKDQGGHYHORSPHQW On behalf of my colleagues on the Board of Directors, I would like to thank AAK's dedicated management team and its hard-working employees around the world for their DFKLHYHPHQWVGXULQJ<RXUJUHDWHIIRUWVKDYHIXUWKHU VWUHQJWKHQHG\$\$.DQGSXWWKHFRPSDQ\LQDYHU\SURPLVLQJ SRVLWLRQIRUWKHXSFRPLQJ\HDUV

Melker Schörling, Chairman of the Board

Chairman of the Board: &RQWLQXHGJURZWKDQGGHYHORSPHQW

CEO: Another successful year for AAK

During the past year AAK has undoubtedly seen some very important and interesting achievements. Most importantly, we have again achieved solid organic growth in our speciality and semi-speciality segments. Furthermore, we have expanded our geographic footprint by completing two large JUHHQ¿HOGSURMHFWVDVZHOODVDGGLQJDQDGGLWLRQDOVWUDWHJLF acquisition. Further, the integration of previous acquisitions is on plan. We have also continued to develop innovative and value-adding solutions together with our customers, backed up by material additions of sales specialists, customer codevelopment specialists and appropriate innovation centers. Our strategy works!

The positive trends from 2015 have continued and 2016 VKRZHGDQRWKHUVROLG¿QDQFLDOSHUIRUPDQFHZLWKDQDOOWLPH KLJKRSHUDWLQJSUR¿W2QFHDJDLQ&KRFRODWH &RQIHFWLRQHU\ Fats was the main contributor to the increase in operating SUR¿W)RRG,QJUHGLHQWVKDGDOOLQDOODJRRG\HDUPDLQO\ driven by continued strong performance for Special Nutrition SULPDULO\,QIDQW1XWULWLRQ?DQG'DLU+RZHYHU%DNHU\KDG a challenging year. Our smallest business area, Technical 3URGXFWV )HHGVKRZHGJRRGGHYHORSPHQWGXULQJ ,WLVDOVRYHU\VDWLVI\LQJWKDWGHVSLWHDYHU\PDWHULDOSHDN in investments, our ROCE stayed stable. Speaking about

investments, 2017 will be another year above historic levels but clearly below 2016. From 2018 we will be back to normal investment levels.

End of AAKtion – and the management ambition achieved

With the completion of the AAKtion program, we are happy to announce that the overall implementation of the program has progressed well over its three years. Expansion in growth markets and other important markets have been an integral part of AAKtion and this has continued during the year.

,Q-XO\ZHDQQRXQFHGWKDWZHKDGDFTXLUHGWKHOHDGLQJ US West Coast based vegetable oils company California Oils Corporation. The company, also known as CalOils, is based in Richmond, California. A strong presence on the US West Coast has been a priority for several years. The West Coast encompasses 20 percent of the US population and economy DQGWKLVH[SDQVLRQZDVLGHQWL¿HGYHU\HDUO\DVDQLPSRUWDQW component of our long-term growth strategy. The acquisition of CalOils will transform AAK into a true national speciality and semi-speciality edible oils company, improving our ability to serve existing customers on a national scale while at the same time creating new customer opportunities.

During the year we have also completed our two new speciality and semi-speciality factories in Brazil and China which open up many new business possibilities in a wide range of applications. With the production plants in operation ZHKDYHWDNHQDPDMRUVWHSIRUZDUGLQRXUJOREDOJURZWK strategy and moved closer to our customers in two hugely important markets.

During the course of AAKtion we have also, through investments in the organization, further developed our capabilities to provide our customers with tailor-made solutions. New Customer Innovation Centers have been opened and resources have been added particularly in New Product Development, Customer Innovation and Sales. These investments have enabled some important product launches, among them our chocolate solution TROPICAO™ which could be the largest value-adding novelty in our industry for PDQ\HDUV7KH¿UVWVDOHVRIWKLVUHYROXWLRQDU\VROXWLRQDUH expected during the second half of 2017.

In 2010, we launched a management ambition to double RXURSHUDWLQJSUR¿WIURP6(.PLOOLRQWR6(. million. With some support from acquisitions and positive FX, we achieved that ambition at the end of 2016, despite all the investments made in the organization in order to build a stronger AAK for the mid and long term and the unexpected head winds absorbed in for AAK important markets like Russia, Ukraine, Turkey and the Middle East.

Beginning of The AAK Way – and our new management ambition

The end of AAKtion also marked the beginning of our new company program, The AAK Way, which will guide us up through 2019. Our key focus with The AAK Way is to enable the company to continue to deliver strong organic growth. 7KLVZLOOEHDFKLHYHGE\IRFXVLQJRQ¿YHSULRULW\DUHDV*R to Market, Operational Excellence, Special Focus Areas, Innovation, and People.

In parallel with our new company program we have established a new management ambition for the coming years. We expect, on average, a 10 percent year-over-year LPSURYHPHQWLQRSHUDWLQJSUR¿WZKLFKZLOOVXSSRUWDJRRG and consistent improvement in earnings per share. The ambition will be achieved through organic growth, innovation, a FRQWLQXHGLPSURYHGSURGXFWPL[DQGDQLPSURYHGHI¿FLHQF\

7KH\$\$.:D\VHUYHVVHYHUDOLPSRUWDQWSXUSRVHV¿UVWRI DOOWROLYHXSWRRXUYLVLRQ±WREHWKH¿UVWFKRLFHIRUYDOXH adding vegetable oils solutions; secondly, to reach the DIRUHPHQWLRQHGPDQDJHPHQWDPELWLRQDQG¿QDOO\WREXLOG an even stronger AAK, for the short, mid and long term.

7KH\$\$.:D\ZDVODXQFKHGLQ-DQXDU\7KH¿UVWPRQWKV with the program have developed according to plan. We are, of course, very much looking forward to the continuous execution of the program, creating even more value for all of our stakeholders – customers, shareholders, employees and suppliers.

Sustainable growth

In the past year we have seen some considerable achievements within our sustainability activities. There have been continued and very important developments within our palm oil sustainability commitments. By August 2016, we had achieved 98 percent traceability of palm oil, palm kernel oil and residuals back to mill origin. In parallel, qualitative risk assessments had been completed for all suppliers, geospatial assessments had been completed for all high-risk VXSSOLHUPLOOVDQGRQVLWHYHUL¿FDWLRQDXGLWVDQGVXSSOLHU engagement workshops had been carried out.

In addition, on the shea kernel side, our work with women's groups in West Africa continues to show great progress. During the season 2015/2016, we have included 90,000 women, exceeding our expectations by more than 20,000.

Our continued focus on key areas has produced many PRUHVLJQL¿FDQWUHVXOWVGXULQJWKH\HDUDPRQJVWWKHPD VWURQJSURJUHVVRQRXUUHVRXUFHHI¿FLHQF)XUWKHUPRUH ZHPDQDJHGWRUHGXFHZDVWHVHQWWRODQG¿OOE\SHUFHQW :DVWHWRODQG¿OOUHSUHVHQWHGSHUFHQWRIWRWDOZDVWH disposals, leaving 98.7 percent disposed for reuse, recycling or recovery.

:HDUHRIFRXUVHYHU\SURXGRIWKHVLJQL¿FDQWSURJUHVV that we have made across all of our key areas. Sustainable growth is a foundation for future success and essential to our DVSLUDWLRQVWREHRXUFXVWRPHUV¶¿UVWFKRLFH

Promising future

Over the last few years we have built, and we continue to build, a very solid foundation. We are supported by strong business drivers, we have a strong organization, and we have had, and will continue to have, a clear and very wellaligned strategy and strategy execution.

Supported by these prerequisites we will continue to work hard in order to create even better conditions and opportunities for all of our stakeholders. One of our main priorities going forward will be to further increase the organic growth in more of our speciality and semi-speciality products through our dedicated work with customer co-development.

We continue to remain prudently optimistic about the future. 2016 has seen some very good achievements and we are determined to bring that momentum into 2017 and the years ahead.

By way of conclusion, I would like to thank all of our customers, shareholders, our Board of Directors, and our business leaders and all their teams for their support during the past year.

Arne Frank, CEO

AAK's vision

³7KH¿UVWFKRLFHIRUYDOXHDGGLQJYHJHWDEOHRLOVROXWLRQV´

Our vision consists of three important parts:

First choice

  • 7KH¿UVWFKRLFHIRURXUVWDNHKROGHUVFXVWRPHUVHPSOR\HHVVXSSOLHUVDQGVKDUHKROGHUV
  • We aspire to be our customers' preferred choice which requires us to be competitive, to have consistent quality standards, and to be an innovative supplier.
  • First choice is also about time. We aim to have a fast time to market of new, value-adding solutions.

Value-adding solutions

  • :HVHOOFRPSOHWHVROXWLRQVQRWMXVWSURGXFWV
  • Our value-adding solutions are based on our expert knowledge of customer needs and developed through our unique co-development approach.
  • \$YDOXHDGGLQJVROXWLRQLVQRWMXVWD¿QDOSURGXFWEXWDOVRDFRPSOH[EXQGOHRIVHUYLFHVVXFKDVFXVWRPL]DWLRQ problem-solving, market advice, delivery systems, technical support and whatever else is required to meet our customers' needs.

Vegetable oils

  • Our business is built around the world of vegetable oils.
  • We offer a wide range of products and services related to vegetable oils.
  • Our unique multi-oil and multi-process approach gives us a wide variety of possibilities and allows us to provide customized solutions.

The AAK Way

Our three-year company program AAKtion has now been completed and 2016 was another exciting year in the execution of the program with many important achievements across the globe within many functions. This has given us a very strong foundation for starting the execution of our new company program.

Our new program, which will guide us up through 2019, is called The AAK Way and is based on six strategic cornerstones:

  • Speciality and semi-speciality products.
  • Customer co-development.
  • Sustainable growth.
  • Global reach aligned with high-growth markets and segments.
  • Strong local presence.
  • Multi-oil and multi-process.

The key focus for The AAK Way is to enable AAK to continue to deliver strong organic growth. This will be achieved by IRFXVLQJRQ¿YHSULRULW\DUHDV±*RWR0DUNHW2SHUDWLRQDO Excellence, Special Focus Areas, Innovation, and People.

Go to Market

Being the Co-Development Company we create lasting value for our customers through value-adding vegetable oils and fats solutions. Our Go to Market approach is to partner with our customers all the way – from identifying their needs, through creating the right solutions for them, to the actual sales. Our way of selling and our unique customer codevelopment approach are business tools we want to strengthen even further over the next three years.

Operational Excellence

In accordance with our brand promise and to manage the ever-increasing competition in the market, it is important that we have operational excellence all the way from sourcing our raw materials in a cost-competitive and responsible way, via a cost-effective production to delivering on time and in quality.

Special Focus Areas

AAK's core business is to develop and supply vegetable oils DQGIDWVVROXWLRQVWRVROYHFXVWRPHUVSHFL¿FQHHGVDFURVV industries such as bakery, chocolate and confectionery, cosmetics, and infant nutrition. To further strengthen our organic JURZWKZHKDYHLGHQWL¿HGVRPHVSHFLDOIRFXVDUHDVZKLFK ZHEHOLHYHKROGVLJQL¿FDQWSRWHQWLDOIRUIXWXUHJURZWK

Innovation

Innovation is crucial to drive future organic growth and to build an even stronger AAK for the mid and the long term. This is decisive for being the preferred supplier and for securing that our solutions add strong value to our customers. When it comes to innovation capabilities we want to be in a league of our own for new ideas, and subsequently executing them with a sense of urgency, and fully commercializing them.

People

We want AAK to be a great place to work, a place where we set a high standard for performance, where everybody is highly engaged, where possibilities for personal development are provided, and where strong leaders both support and challenge all colleagues in an organization to last. We also continuously want to prepare our workforce for the ever-changing future.

The AAK Way serves several important purposes:

  • 7ROLYHXSWRRXUYLVLRQWREHWKH¿UVWFKRLFHIRUYDOXH adding vegetable oil solutions.
  • To reach our management ambition improving, on DYHUDJHRXURSHUDWLQJSUR¿WE\SHUFHQWSHU\HDUDQG supporting a good and consistent earnings per share improvement.
  • To build a stronger AAK for the short, mid and long term.

A few months after our global launch of The AAK Way, the implementation of the program is developing according to plan. We are looking forward to the continuous execution of The AAK Way in order to create even more value for all of our customers and other stakeholders.

The business model – global provider of value-adding solutions

AAK's core business is to provide value-adding solutions, based on speciality vegetable oils and fats, to the food, confectionery and cosmetics industries with the purpose to achieve lasting business value together with our customers. Sourcing renewable raw materials from around the globe, we manufacture our broad product portfolio at more than 20 production facilities and customization plants around the world.

As markets are evolving throughout the world, new opportunities and challenges continuously arise. Therefore, it is important for AAK to stay on top of market dynamics. Some of the current consumer trends in our key markets include KHDOWKDQGZHOOQHVVFOHDQODEHOVXVWDLQDELOLW\FRVWHI¿ ciency, and premiumization.

The Co-Development Company

To be able to provide value-adding solutions to our customers we apply our unique co-development approach. This approach is based on long-term partnerships and strong relationships with our customers. This in combination with a great interest in our customers' businesses, enable us to ZRUNZLWKRXUFXVWRPHUVIURPLGHDWRODXQFK±IURPMRLQW ideation, to close cooperation on development and strong support on implementation of the solution. The foundation for the co-development work is our world-leading capabilities:

  • Our multi-oil and multi-process approach which gives us an unmatched capability to provide customized products.
  • Our know-how of oils and fats and their functions in different applications.
  • Our global presence which enables us to address local markets and needs, as well as act as a global partner.

These capabilities make it possible for us to customize solu-WLRQVWKDW¿WRXUFXVWRPHUV¶VSHFL¿FQHHGVDOOZLWKWKHSXUpose to achieve lasting business results. Last but not least, we have dedicated people at our eleven Customer Innovation Centers across the globe working in close co operation with our customers to provide value-adding vegetable oil solutions.

Functional solutions

Our products are of both nutritional and functional value, outstanding in their structure, melting and crystallization EHKDYLRXUUKHRORJLFDOSURSHUWLHVÀDYRXUUHOHDVHDQGVNLQ penetration.

Our strong focus on customization and our multi-oil and PXOWLSURFHVVDSSURDFKHQDEOHXVWRUHVSRQGWRVSHFL¿F FXVWRPHUQHHGVOLNHLPSURYHGKHDOWKSUR¿OHWDVWHSURFHVVing, logistics, labelling and legal requirements. In each case, our technical and commercial experts identify the optimum

8

Our global network of Customer Innovation Centers

Natural raw materials

:HREWDLQRXUUDZPDWHULDOVIURPUDSHVHHGSDOPVR\DVKHDVXQÀRZHUROLYHVDQG many other sources. Drawing on our extensive knowledge, and more than a century of experience, we exploit the properties of vegetable oils to add value to customers within our target industries.

We source raw materials from all over the world:

5DSHVHHGDQGUDSHVHHGRLO Northern and Central Europe

3DOPRLO Asia and Latin America

2OLYHRLO Southern Europe

6R\DEHDQRLO U.S. and South America

6XQIORZHURLO Eastern Europe and Mexico

6KHDNHUQHOV West Africa

&RUQRLO America and Eastern and Southern Europe

&RFRQXWRLO Malaysia and the Philippines

As our customers strive to respond to the fast-changing demands of their markets, it has become increasingly necessary for us to meet their needs by developing customized, highly functional products.

Many customer demands are inspired by the health trends. Our expertise has enabled us to maintain high functionality ZKLOHUHGXFLQJWKHPDMRULW\RILQGXVWULDOO\SURGXFHGWUDQVIDWV believed to increase the risk of cardiovascular disease.

According to the WHO and the Nordic Nutrition Recommendations:

  • the intake of trans fatty acids should be kept at an absolute minimum as any intake of trans unsaturated fatty acids is related to an increase of LDL (the bad cholesterol) in the blood.
  • the intake of saturated fatty acids should be limited to a maximum of 10 percent of the energy intake because of its increasing effect on total cholesterol compared to unsaturated fatty acids.

&RVWHI¿FLHQF\LVDQRWKHULPSRUWDQWWUHQGLQRXUFXVWRPHU demands, either through reduced cost of raw materials or of processing costs. This is driven by a highly competitive market and retailers continuing to challenge the food manufacturers.

Sustainable growth

Sustainable growth is a cornerstone of our company program The AAK Way and essential to our vision of being WKH¿UVWFKRLFHIRUYDOXHDGGLQJYHJHWDEOHRLOVROXWLRQV)RU us, sustainable growth is about our responsibility towards all of our key stakeholders – the local communities where we operate, our global customers, employees, investors, and suppliers. The foundation of our model for sustainable growth is the ten principles of the UN Global Compact, UN's Sustainable Development Goals, and our policies and codes.

'ULYLQJSURJUHVVZHZRUNZLWKLQ¿YHIRFXVDUHDV2XU Customers, Our Suppliers, Our Planet, Our People, and Our Neighbours, where we continuously set and deliver on DPELWLRXVREMHFWLYHVDQGEHQFKPDUNVIRURXUSHUIRUPDQFH internally and externally.

The interaction with customers is based on sound business ethics and a deep understanding of our responsibility for safeguarding customer brands. As a supplier of ingredients for some of the world's best-known brands, we recognize our role and our customers' expectations and see these as key elements in the execution of The AAK Way.

What is fat and why do we need it?

Fat is essential to life. The many types are divided into four main groups:

  • 6DWXUDWHGIDWis found in animal products such as butter, cream, milk, meat and vegetable oils from tropical plants, such as coconut oil and palm oil. Saturated fats are characterized by their ability to remain solid at room temperature.
  • 0RQRXQVDWXUDWHGIDWis found in almonds, olive oil, rapeseed oil and other vegetable oils. Monounsaturated fat is suitable for cooking, being more heat-stable than polyunsaturated fat.
  • 3RO\XQVDWXUDWHGIDWLVIRXQGLQVKHOO¿VKRLO\¿VKVXFKDV salmon, mackerel, herring and sardines, and vegetable oils. Omega-3 and omega-6 are examples of polyunsaturated fats.
  • 7UDQVIDWVare a particular form of unsaturated fats. They occur naturally in milk and fat from ruminants, but are also formed when vegetable fat is partially hydrogenated.
Fat is part of all the cells in the body. Our bodies
need fat to produce hormones and other important
substances.
  • Vitamins A, D, E and K are fat-soluble. That means that the body's ability to absorb these vitamins is dependent on the presence of fat.
  • One third of our daily energy requirements must be met by calories from fat. For adults, this means a daily fat intake of 60–90 grams, each gram containing nine calories. Carbohydrates and proteins contain four calories per gram.
  • Saturated fats and trans fats are believed to LQFUHDVHWKHOHYHORI/'/FKROHVWHURO³EDG´ cholesterol) in the blood, while unsaturated fats have a positive effect on blood cholesterol.

%XVLQHVVDUHD)RRG,QJUHGLHQWV

Our largest business area Food Ingredients primarily offers solutions to the bakery, dairy, special nutrition, and foodservice industries. All in all, the business area reported good organic growth 2016 with an increase in speciality and semi-speciality solutions, but the picture between the different segments was very mixed. Dairy and Special Nutrition, comprised of Infant, Senior and Medical Nutrition, showed good organic growth while Bakery continued to struggle.

2SHUDWLQJSUR¿WSHUNLOR

Volumes (69% of Group total)

Food Ingredients

6(.PLOOLRQ

2016
9ROXPHVWKRXVDQGWRQQHV

1HWVDOHV

14,707
2SHUDWLQJSURILW

996
2SHUDWLQJSURILWSHUNLOR6(.

Bakery

Bakery, our largest segment within Food Ingredients, had another challenging year and ended up on a slightly lower level than in 2015, with the exception of Central and Eastern Europe. However, the innovation pipeline looks solid and we expect to launch new value-adding solutions during 2017 to further strengthen our customer offer in this segment.

In December 2016, AAK Colombia launched new, highquality margarines for pastries and cakes and is expected to take a leading position in the market for value-adding solutions. Brazil with its new factory is gaining ground within bakery and the outlook for 2017 is rather positive, taking into account the tough economic environment in the country.

The shift towards value-adding solutions is very clear in WKH86ZKHUHVRPHQHZYDOXHDGGLQJEXVLQHVVZLWKÀDNHG solutions was gained. The bakery industry in China showed good volume growth during 2016 and we expect a good start for our newly inaugurated speciality and semi-speciality edible oils factory outside of Shanghai.

Dairy

2016 was a strong year for our dairy business with doubledigit volume growth. North Latin America, the US and the Nordics showed particularly strong growth in this segment. The new growth markets Brazil and China very importantly showed great development. Although coming from a small base this is a very positive indication for the return of our investments in the two countries and it will strengthen our global position within the dairy business.

One important focus area within our Dairy segment has been to broaden the business by developing a range of unique value-adding solutions for the plant-based dairy market. Through our co-development approach we are strongly positioned to grow further within this sub-segment which is expected to exhibit double-digit growth every year for the upcoming three years.

Special Nutrition

Infant Nutrition, which is the largest sub-segment within Special Nutrition, has continued to show strong global growth during 2016. In general, the global infant nutrition market continues to grow with good momentum, mainly driven by the Chinese market. However, our product range Akonino®, with its tailor-made solutions, is still outgrowing the market and gaining market shares through good developments in Europe, North America and Asia. InFat ®, a structured lipid component for infant formulas which is sold through \$GYDQFHG/LSLGV\$%DMRLQWYHQWXUHRI\$\$.DQG(Q]\PRWHF continued to grow as well.

With our new focus areas Medical and Senior Nutrition, we will broaden our market coverage for specialized oils and fats going forward. These two sub-segments show growth all over the world. Our proven track record of being a reliable supplier, combined with our customer co-development approach, will enable us to grow further in the strong and competitive segment of Special Nutrition.

Foodservice

)RRGVHUYLFHKDGDQRWKHUVWURQJ\HDUJURZLQJVLJQL¿FDQWO\ faster than the market – a market that is rapidly evolving as consumers' propensity to eat out is on the increase and as their behaviours are changing.

AAK recognizes the regional variations in the taste and functionalities that our customers seek. Therefore, we strive WRDGDSWRXUVROXWLRQVWRFUHDWHWKHJUHDWHVWSRVVLEOHEHQH¿W for our customers' businesses and for the end-users' food H[SHULHQFHV7KHW\SLFDOIXQFWLRQDOLWLHVZHRIIHULQÀXHQFHWKH WDVWHDSSHDUDQFHDQGWH[WXUHRIWKH¿QDOSURGXFW

Within Foodservice AAK has a very strong market focus DQGZHGHOLYHULQQRYDWLYHVROXWLRQVWKDWUHÀHFWWKHQHZHVW market trends. In 2017 we will renew and expand our Customer Innovation Centers for Foodservice, where we work with customers and suppliers to develop new recipes ZLWKJUHDWÀDYRXUVDQGWH[WXUHV

%XVLQHVVDUHD&KRFRODWH &RQIHFWLRQHU)DWVKDGDQRWKHUVWURQJ\HDUGULYHQE\FXVWRPHUFRGHYHORSPHQWWDNLQJ RXUQHZLQQRYDWLYHVROXWLRQVWRPDUNHWDQGDFRQWLQXHGH[SDQVLRQRIRXUJHRJUDSKLFDOIRRWSULQW2XUYLVLRQLVWREH WKHZRUOGOHDGLQJVXSSOLHURIYDOXHDGGLQJVSHFLDOLW\IDWVROXWLRQVWRWKHOHDGHUVLQWKHFRQIHFWLRQHU\LQGXVWU\DQGWR EULQJEUHDNWKURXJKLQQRYDWLRQVWRWKHPDUNHW

2SHUDWLQJSUR¿WSHUNLOR

&KRFRODWH &RQIHFWLRQHU)DWV

6(.PLOOLRQ

9ROXPHVWKRXVDQGWRQQHV

1HWVDOHV

2SHUDWLQJSURILW

2SHUDWLQJSURILWSHUNLOR6(.

%XVLQHVVDUHD &KRFRODWH &RQIHFWLRQHU)DWV

Bringing breakthrough solutions to market

Chocolate & Confectionery Fats supplies speciality vegetable fats used for cocoa butter replacement and improvement LQFKRFRODWHSURGXFWVDQG¿OOLQJV%DVHGRQWKHPDUNHWDQG customer needs, we offer a wide product portfolio. Many of our new product launches are developed and customized in close cooperation with our customers. Our solutions for the confectionery industry cover a wide range of product applications, including chocolate fats and compound fats for coating DQGPRXOGLQJ¿OOLQJIDWVEDUULHUIDWVDQGVSUHDGV

In 2016, we have focused on taking our breakthrough innovation TROPICAO™ to the market. TROPICAO™ makes it possible for chocolate manufacturers to produce bloomstable chocolate and still maintain the chocolate's sensorial properties even under very warm conditions. We have been working closely with customers on implementing and testing this new and exciting innovation. At the same time we have continued to work on new innovation.

Recognizing the regional variations in the functionalities our customers seek, we strive to adapt our solutions to FUHDWHWKHJUHDWHVWSRVVLEOHEHQH¿WIRUWKHFXVWRPHUV¶ businesses and to the end-users' chocolate experiences. 7KHW\SLFDOIXQFWLRQDOLWLHVZHRIIHULQÀXHQFHWKHWDVWH DSSHDUDQFHDQGWH[WXUHRIWKH¿QDOFRQIHFWLRQHU\SURGXFW Consistent with AAK's strong market focus, we deliver LQQRYDWLYHVROXWLRQVWKDWUHÀHFWPDUNHWWUHQGVDQGDQWLFLSDWH customer requirements. Our wide product range is the result of targeted development work carried out in our Customer Innovation Centers, where we work with our customers. AAK offers technical service to our customers to optimize the use of solutions in their factories. We often organize academies for customers to inspire them with newly developed applications and concept proposals for use in their products.

2XULQQRYDWLYHSURMHFWVWRGHYHORSKHDOWKLHUYHUVLRQVRI our products have proven to be successful. We are able to offer products that both comply with high food safety standards and that are free of trans fats and low in saturated fats. Today, most of our products are completely without trans fats.

Products for every customer's need

Our products and value-adding solutions offer customers an opportunity to differentiate their confectionery products to make them preferred by consumers. We offer a customized product range under the following brands:

  • TROPICAO™ a solution that helps chocolate to maintain a non-bloom appearance as well as its sensory attributes when exposed to temperatures up to 37°C (98.6°F).
  • Illexao™ Cocoa Butter Equivalents or Improvers (CBE/CBI) for chocolate cost reductions or chocolate with added or improved functionality.
  • Akopol™ Cocoa Butter Replacers (CBR) for compounds with cocoa tolerance.
  • Cebes™/Silko™ Cocoa Butter Substitutes (CBS) for compounds with fast meltdown and fast crystallization.
  • &KRFR¿OO™/Deliair™±)LOOLQJ)DWVIRUFXVWRPL]HG¿OOLQJV in line with customer needs.

\$W\SLFDOFKRFRODWH¿OOLQJFRQWDLQVSHUFHQWIDWZKLFK plays a key role in securing a good chocolate experience in WHUPVRIVWDELOLW\PHOWLQJSURSHUWLHVWH[WXUHÀDYRXUUHOHDVH DQGKHDOWKSUR¿OH\$GGLWLRQDOEHQH¿WVRIRXUSURGXFWUDQJH include improved mouthfeel and prolonged bloom stability for DORQJHUVKHOIOLIH(I¿FLHQWEDUULHUIDWVDOORZWKHLQFOXVLRQRI IRUH[DPSOHQXWVLQD¿OOLQJ

Right raw materials

Every stage of our value chain requires specialist expertise – from purchasing of raw materials to marketing and sales. When purchasing raw materials, we maintain a high level of quality control to ensure food safety, but also a high focus on initiatives to ensure corporate social responsibility.

For decades, the shea kernel has been an important source of nutrition and income in the rural parts of West \$IULFD:HKDYHEHHQLQYROYHGHYHUVLQFHWKH¿UVWNHUQHOV were exported in the 1950's and are today the biggest consumer of shea kernels outside Africa. Over the past few years, we have successfully shortened the supply chain to include only those participants that actually add value. One consequence of this is that we now also obtain direct supplies from thousands of rural women in Burkina Faso and Ghana.

Personal Care

AAK applies its technological know-how and technical expertise in the development of high-performing, functional emollients for the personal care industry. The vegetablederived ingredients, distinct from synthetic, animal oil- or mineral oil-based raw materials, are used in many cosmetic applications, including skin care, baby care, sun care, hair care, and make-up. Our range of products is highly appreciated for the moisturizing properties and sensory attributes WKH\EULQJWRWKH¿QDOIRUPXODWLRQV

Dynamic market trends

The macro trends of a growing population with increasing buying power in emerging markets, and an aging, active, and appearance-focused population (female and male) in mature Western economies, are key growth drivers behind the continuous volume and value growth of the personal care industry.

Today, the industry has coupled its traditional focus on innovation and novelties with an increased emphasis on functionality, safety and sustainability – a trend that supports the use of natural, yet highly sophisticated and well-documented ingredients which are exactly our specialty.

Global reach

The personal care industry is global. The ten largest companies hold around 50 percent of the global personal care retail market. AAK pursues the strategic and tactical business opportunities that lie within small, medium and global brands – locally and globally.

High-performing and sustainable ingredients

Our personal care ingredients are all made from natural, renewable raw materials, including rapeseed, shea, mango, illipe, and cocoa. Rapeseed grown in Sweden contains high levels of valuable bioactive lipids – excellent for sensitive skin products, sun care and baby care. Shea butter, with LWVEHQH¿FLDOSURSHUWLHVLVWKHPRVWVRXJKWDIWHUYHJHWDEOH based raw material in the cosmetics industry, used in three times as many applications as any other vegetable oil. Shea is widely recognized for its skin-softening and PRLVWXUHUHWDLQLQJSURSHUWLHVZKLOHLWVDQWLLQÀDPPDWRU\ properties are known for their skin-soothing and healing effects.

Product development delivering customer value

Our product range is under constant development. In close consultation with our customers, we are able to shape a well-considered response to meet the ever-changing needs of the industry. Our product innovation focuses on devel-RSLQJSURGXFWVFRPELQLQJVSHFL¿FEDVLFIXQFWLRQVVXFKDV moisturizing or softening properties, with more advanced functions, such as protection against UV rays, pollution or other environmental contaminants, or for improved disper-VLRQRISLJPHQWVDQG89¿OWHUV

\$W\$\$.ZHHQKDQFHWKHSRZHURIQDWXUHZLWKWKHREMHFtive of creating high-performing, yet sustainable, attractive and safe ingredients that satisfy the needs and wants of our customers and the end-user – the consumer. Our strong performance and continued growth in mature as well as in emerging markets clearly illustrates that AAK is a recognized and leading niche supplier to the global cosmetics industry.

2SHUDWLQJSUR¿WSHUNLOR

%XVLQHVVDUHD 7HFKQLFDO3URGXFWV )HHG

7HFKQLFDO3URGXFWV )HHG

6(.PLOOLRQ

9ROXPHVWKRXVDQGWRQQHV

1HWVDOHV

2SHUDWLQJSURILW

2SHUDWLQJSURILWSHUNLOR6(.

2XUEXVLQHVVDUHD7HFKQLFDO3URGXFWV )HHGRIIHUVIDWW\DFLGVDQGJO\FHULQHIRUYDULRXVDSSOLFDWLRQVDQGSURWHLQV DQGIDWVIRUDQLPDOIHHG7KHEXVLQHVVDUHDKDVVHHQJRRGGHYHORSPHQWGXULQJWKH\HDUZLWKSDUWLFXODU\VWURQJ SHUIRUPDQFHIRUWKHWHFKQLFDOIDWW\DFLGVEXVLQHVVUHSRUWLQJJRRGYROXPHDQGSUR¿WJURZWK

DQGDGMXVWHGIRU%LQROGLYHVWPHQW

Technical Products & Feed is an excellent example of the role that vegetable oils play with respect to the environment and health. Candles are one example – made from renew-DEOHIDWW\DFLGVUDWKHUWKDQSDUDI¿QWKHLUFDUERQGLR[LGH HPLVVLRQVDUHVLJQL¿FDQWO\ORZHU:LWKLQIDUPLQJGDLU\FDWWOH FDQEHQH¿WIURPYHJHWDEOHEDVHGIHHGWKDWKDVH[FHOOHQW nutritional properties.

Tefac – industrial applications

Fatty acids and glycerine are produced by splitting the fat PROHFXOHDQGUH¿QLQJWKHRXWFRPHLQWRKLJKSXULW\SURGXFWV Using by-products from speciality oils manufacturing and other sources of raw materials, AAK's Tefac business creates value-adding solutions for the customer.

Fatty acids are basic oleochemicals which are used as raw materials for production of a wide range of products such as detergents, surfactants, paper chemicals, lubricants, and plastic and rubber additives. They are also used directly in tyre manufacturing and candle production. In candle making fatty acids provide a natural, sustainable alternative WRSDUDI¿Q7KH\$\$.SURGXFWVPD\EHIRXQGLQHFRODEHOOHG candles made from 100 percent stearin.

Glycerine is used in a diversity of products, for example anti-freeze agents, tobacco products and surface coatings. Over the last years the glycerine market has undergone a

radical change due to the growth of the biodiesel industry, which also generates glycerine as a by-product. Vastly increased supply has caused prices to fall. However, low prices have resulted in new applications for glycerine.

Feed

AAK's feed business manufactures and markets vegetable oils & fats and protein for animal feed. Protein is sold under our ExPro® brand. The patented ExPro® process is used to modify the rapeseed protein structure in a way which makes LWE\SDVVWKHFRZV¶UXPHQ¿UVWVWRPDFK?%\SDVVLQJWKH rumen increases the uptake of amino acids which leads to increased milk yield and protein content in the milk. The ExPro® process also kills off harmful bacteria that may be present in the protein meal.

AkoFeed® is our brand for vegetable oils & fats used for feeding of farm animals. Fats are mainly added to farm animal diets to increase energy concentration and growth, but can also be used to increase milk yield and fat content in the milk.

Products from AAK's feed business all aim to improve cost HI¿FLHQF\IRUIDUPHUVDQGIRURXUFXVWRPHUVLQWKHFRPSRXQG feed industry.

Europe

%XVLQHVVG\QDPLFVLQ(XURSHLQVLJQL¿FDQWO\GLIIHUHG between the various markets. Overall, we maintained our market position while continuing to develop our value-adding solutions across the various applications and channels to market. Our investments in our AAKtion program, and VSHFL¿FDOO\LQRXU*RWR0DUNHWWHDPVKDYHHIIHFWLYHO\ allowed more time in the markets with our customers.

Our momentum in Eastern Europe, including Russia, 8NUDLQHDQGWKHVXUURXQGLQJFRXQWULHVLPSURYHGVLJQL¿ cantly – albeit from relatively low levels – as we gained new business with both existing and new customers. Northern and Western Europe remained a highly competitive business HQYLURQPHQWZKHUHGLIIHUHQWLDWLRQWKURXJKFXVWRPHUVSHFL¿F innovations allowed us to strengthen our core for future performance. The Bakery segment has performed below H[SHFWDWLRQV+RZHYHUZHUHPDLQFRQ¿GHQWDQGGHWHUPLQHG to enhance performance going forward. Focus on both global and regional strategic accounts resulted in increased share of wallet and in the development of stronger opportunity pipelines.

Customer and consumer concerns clearly increased and centered on sustainability and health, including food safety. Both topics dominated the agenda of the food industry and FRQ¿UPHGWKDWRXUFRQWLQXHGLQYHVWPHQWVDQGFRPPLWPHQW to these critically important aspects are paying off. Our supply chain is recognized as robust and fully compliant and continue to be best in class.

Our new offerings, whether for our strongholds Chocolate & Confectionery Fats, Infant Nutrition, Bakery and Foodservice, or for our strengthening applications within Dairy and Special Nutrition, are well-received and proof that customer intimacy and innovation through our co-development approach are key to success.

Regional markets

Latin America

AAK Mexico holds a leading position in all segments of the processed food industry and we have seen growth within all of them. Our focus on co-developed solutions beyond oils has resulted in broader and deeper business relations with our customers and allowed us to differentiate ourselves from our competitors. We are well equipped to serve a very demanding market that requires solutions with better IXQFWLRQDOLW\ORZHUFRVWRIXVHDKHDOWKLHUSUR¿OHDQGWKDW are sustainable. Furthermore, AAK Mexico has, without a doubt, led the industry in eliminating partially hydrogenated oils in food.

AAK Colombia is settling in well and is starting to be recognized as a value-adding solutions provider. The launching RI.|QGLWRULWKH¿UVWDQGRQO\SUHPLXPPDUJDULQHEUDQGLQ Colombia, as well as co-developed solutions for all segments, have set new business ground for future sustained growth and positioned AAK Colombia as the only truly innovative vegetable oils company in the country.

Our new speciality and semi-speciality factory in Jundiaí, Brazil was inaugurated during the year. To be able to deliver the whole product range a gradual ramp-up will continue during the coming quarters. Despite the tough economic environment in the country the outlook for 2017 and beyond looks rather positive.

Operations in Uruguay, which is particularly strong in Chocolate & Confectionery Fats, showed good development during 2016.

USA

2016 once again brought strong organic growth for AAK USA across a broad spectrum of segments, including Special Nutrition (primarily Infant Nutrition), Chocolate & Confectionery Fats, and Dairy. Again, AAK USA reached DUHFRUGKLJKRSHUDWLQJSUR¿W3HQGLQJ86)RRGDQG'UXJ Administration regulations regarding removal of partially hydrogenated oils (PHOs) in all food categories has brought, and will continue to bring, numerous opportunities to codevelop new solutions with customers across all segments.

Numerous investments in assets and people have been made in 2016 to support a strong Go to Market approach including a new Customer Innovation Center in Edison, New Jersey featuring a Chocolate & Confectionery Fats lab and a Bakery lab with equipment that enables our Customer Innovation team to mimic nearly all of our customers' applications in these segments. Further investments are on the drawing board for both Dairy and Personal Care labs.

AAK's foodservice business continues to be a market leader in the Northeast and Mid-Atlantic states where our dressings, sauces and mayonnaise products continue to be standards of excellence.

2016 also brought the acquisition of California Oils Corporation at the end of August. With the acquisition of this business and processing facility in Richmond, California, AAK is now the only oils & fats processer in North America with facilities on both the East and West Coasts. This uniquely positions AAK to serve industrial food producers across the entire USA and Canada.

Asia

In 2016 operations in Asia progressed overall as expected and there were many positive developments.

Several markets reported good organic growth and we see good opportunities across the whole region from the Middle East to all of Asia.

AAK's business in China has changed rapidly and is today fully operational. AAK has a strong sales and customer platform supported by an integrated supply chain and a plant for speciality and semi-speciality products. The plant will increase our capacity by approximately 100,000 MT when it is fully ramped up. China is undergoing a transition from an export-driven economy to a more domestic-driven one and this is expected to create further demand for our full range of solutions.

AAK Kamani has been a real success story in India where we have presented many new offerings and launched a number of breakthrough innovations. Underlying growth in India is solid and we expect the market to develop strongly as demand continues to grow. During 2016, we invested in a new Customer Innovation Center in Mumbai as well as in increased capacity and plant upgrades.

Our business in other parts of Asia as well as Turkey and the Middle East developed positively. We successfully continued to implement the AAK business model where the focus is on co-development and collaboration with customers either through our own operations (such as Turkey, the United Arab Emirates – from the second half 2016, Malaysia, Singapore, Australia and Japan) or through designated partners.

We have successfully extended our brand promise throughout the Asian region supported by our investment in strategically located Customer Innovation Centers. We remain committed to this path of development in 2017 and beyond.

Risks

AAK's operations are constantly exposed to risks, threats and external factors with an impact on the company. Through a proactive approach to business intelligence, the company aims to anticipate changes in factors affecting operations. Plans and policies are adjusted continuously to counteract potential negative effects. Active risk management, such as hedging raw material prices and currencies, reduces the risks that the company faces.

Raw materials

Harvests are weather-dependent. While a year of poor harvests drives up prices, a year of successful harvests reduces them. Most of our raw materials are traded on the international world market, where they are purchased in foreign FXUUHQFLHV7KLVH[SRVHVXVWRVLJQL¿FDQWFXUUHQF\DQGUDZ material price risks.

Our strategy of active risk management means that, as soon as a sales contract is signed, we hedge the equivalent currency and raw material price exposure. This safeguards margins against price risks on agreed sales contracts.

Since many raw materials are produced at a considerable distance from our production plants and markets, transport costs are an important factor. Particularly the potential impact on margins from the growing demand for environmentallyacceptable transport methods has to be taken into consider-DWLRQ&RPSHWLWLRQLQFRPPRGLWLHVLV¿HUFH

The processing industry

AAK is part of the processing industry. Improvements in results are achieved through organic volume growth and by increasing sales of speciality products with higher margins relative to lower-margin bulk products.

Capacity expansion aimed at increasing total volumes in order to meet growing demand has a relatively long planning horizon. AAK must analyze potential growth in good time. In the meantime, it is possible to balance production among RXUSODQWVWRHQDEOHSURFHVVLQJRIVSHFL¿FSURGXFWVFORVHU

to their markets and accommodate swings in supply and demand. Key speciality products are produced at dedicated SODQWVZKHUHSUREOHPVZLWKPDFKLQHU\FDQKDYHDPDMRU impact. During 2016, our new production plants in Brazil and China were completed and a gradual ramp-up of the operations will continue in 2017.

Political instability

Operating globally always carries risks, but it can also be a stabilizing factor. Although AAK largely operates in mature markets in the US and Europe, much of company growth is generated in developing markets, which are vulnerable to political instability that can impact currencies and exchange rates. We also operate in Eastern Europe, the Middle East, Asia, Africa, and South America, where instability may arise. As a well-established operator in these areas, we have extensive experience of handling such issues. In addition, we operate with a deliberate risk management strategy.

Global operations involve a number of other risks, including:

  • Trade barriers.
  • ,QÀDWLRQ
  • Changes in national or regional legislation, e.g. the introduction of protective tariffs and taxes, which prevent AAK from operating in a free market.
  • Environmental and health-related legislation.

Changes in the competitive environment

The sector in which AAK operates is undergoing structural FKDQJH\$VDVHFWRUWKDWKDVH[LVWHGIRUMXVWRYHUDFHQWXU\ and has a fundamental dependence on natural products, there is great pressure for more intensive development. This includes demands for sustainable, ethical production, where producers accept responsibility for social issues and the environmental impact of their operations. AAK operates on the basis of an organic growth and selective acquisition VWUDWHJ\$VWURQJEDODQFHVKHHWKDVODLGWKH¿QDQFLDOIRXQdations for future acquisitions.

There is tough competition in the industry. Several global competitors deliver large volumes of bulk products with limited margins. Our response is to focus more on products with better margins and higher-added value. These include confectionery products and cosmetics, as well as valueadding ingredients for the bakery, dairy and infant nutrition industries.

The health trend

There is an ongoing debate on healthy alternative foods. The trans fat debate, for example, has been quite heated on occasion, resulting in a greater use of raw materials such DVSDOPRLO3DOPRLOLVDVLJQL¿FDQWUDZPDWHULDOIRUXVDW AAK and has a broad application area – from chocolate to foods and cosmetics. A great alternative to hardened fat, it is semi-solid at room temperature, making it an attractive choice in the production of many foods. By using palm oil, trans fats can be eliminated from many food products.

We have the ability to adapt our product range quickly to the latest trends in the health debate. This is largely due to the fact that we work with all types of vegetable oils and can reformulate our products fairly easily to meet customer needs. We focus strongly on product co-development with our customers. This limits the risks involved in commercializing new products.

Regulatory measures also pose a risk. Active involvement in Corporate Social Responsibility-related issues is, therefore, becoming increasingly important to forestall legislation on issues that are a natural development of human requirements.

Changes in external factors

Business operations are affected by raw material prices, transport costs, energy prices, interest rates and exchange rates. Our employees are experienced in reacting quickly to changes in external factors and adapting operations, products and services to customer needs.

Employees

Just as we are co-developing with our customers we are also co-developing with our people. AAK has employees in more than 25 countries on six continents. We have 20 production facilities and customization plants across the world and a global procurement and sales organization. Organic growth, investments in production facilities and acquisitions are expanding that global presence.

In 2016, we were pleased to welcome 65 new colleagues from California Oils Corporation, also known as CalOils, to the AAK family. During the year, we have also completed two new factories, one in Jundiaí, Brazil and one in Zhang-MLDJDQJ&KLQD±JUHHQ¿HOGSURMHFWVWKDWRIFRXUVHGHPDQGD large number of new recruitments, training and preparation.

AAK had an average of 2,971 employees in 2016 – an increase compared to the prior year due to the mentioned JUHHQ¿HOGSURMHFWVRXUFRQWLQXHGRUJDQLFJURZWKDQG acquisitions.

Building an organization for future growth

7KH³3HRSOH´SURMHFWZLWKLQ\$\$.WLRQRXUFRPSDQ\SURJUDP for 2014–2016, has been developing according to plan and KDVUHVXOWHGLQLPSURYHPHQWVRIZRUNÀRZVSURFHVVHVUROHV and responsibilities. AAKtion has now been replaced by our new three-year program The AAK Way, under which the ³3HRSOH´SURMHFWZLOOFRQWLQXH7KHLPSRUWDQWDFKLHYHPHQWV ZLWKWKHSURMHFWWKXVIDUKDYHEHHQPDQ\

For example, we have updated our AAK Trainee Program. 'XULQJZH¿QDOL]HGRXUIRXUWKSURJUDPDQGZHOFRPHG nine new graduates (selected from 808 applicants) to a new program, which this year also includes an international assignment and even more training days.

We have also continued and updated our AAK Sales Training Program, CCV (Creating Customer Value). In 2016, more than 75 people completed the CCV training and an additional 55 people initiated training to be completed in 2017. There has also been an increased focus on both the quality and the timely completion of our Personal Development Plans (PDPs).

Furthermore, during 2016 AAK conducted a global employee engagement survey. A few local engagement surveys have been conducted before, but in June 2016 we carried RXWRXU¿UVWJOREDOVXUYH\WRJHWKHUZLWK*UHDW3ODFHWR:RUN 86.6 percent of our employees completed the survey making our participation equal to the top tier companies that have a much stronger tradition of engagement surveys. During the second half of the year, based on the survey results, many activities were initiated in local leadership teams and with a high level of employee participation and engagement.

/DVWEXWQRWOHDVW\$\$.KDVGH¿QHGOHDGHUVKLSFRPSHtencies as a foundation for future leadership development ZLWKLQ\$\$.\$VD¿UVWVWHSWKHVHFRPSHWHQFLHVKDYH been introduced to more than 300 managers globally.

Going forward

AAK strives to be an attractive employer with a high-performance organization, built on strongly aligned values with an increasing number of people carrying AAK forward. To succeed, we will continue to GHYHORSRXU³3HRSOH´SURMHFWE\IRFXVLQJRQOHDGHUVKLS development, by continuing to develop our people with an increased focus on e-learning/online training, and by strengthening our values and our internal recruitment pipeline.

(PSOR\HHV
E\DJH

(PSOR\PHQWFRQWUDFWW\SH

(PSOR\HH FDWHJRU\E\DJH

(PSOR\HHV
E\DJH

Salaried

(PSOR\HHV
JHQGHU

* Permanent and at-will employees

16% <30 27% 30–39 25% 40–49 32% >49

Our Suppliers

Sustainable growth in AAK

6XVWDLQDEOHJURZWKLVWKHNH\REMHFWLYHRIRXUVWUDWHJ\DQGHVVHQWLDOWRRXUYLVLRQRIEHLQJWKH¿UVWFKRLFHIRUYDOXH DGGLQJYHJHWDEOHRLOVROXWLRQV)RUXVVXVWDLQDEOHJURZWKLVDERXWRXUUHVSRQVLELOLW\WRZDUGVDOORIRXUNH\VWDNH KROGHUV±WKHORFDOFRPPXQLWLHVZKHUHZHRSHUDWHRXUFXVWRPHUVRXUHPSOR\HHVRXULQYHVWRUVDQGRXUVXSSOLHUV ,QZHGHYHORSHGDYLVXDOPRGHOIRUVXVWDLQDEOHJURZWKWRJXLGHRXUJOREDO&65ZRUN7KHPRGHOKDVEHHQ VOLJKWO\PRGL¿HGRYHUWKH\HDUVDQGLVWRGD\NQRZQDV\$\$.¶V+RXVHRI6XVWDLQDELOLW)XUWKHUPRUHWKHVXEVWDQFH RIWKHPRGHO¶VLQGLYLGXDOHOHPHQWVKDVFRQWLQXRXVO\EHHQDGMXVWHGWRWKHPDUNHW

UNGC principles and SDGs

The UN Global Compact (UNGC) is a solid platform and a broad concept based on ten universal principles within Human and Labour Rights, Environment and Anti-corruption. ,WHQMR\VSDUWLFLSDWLRQE\DOORIWKHPDMRUSOD\HUVLQJOREDO business and CSR, including the GRI (Global Reporting Initiative), ETI (Ethical Trading Initiative), ICC (Inter national Chamber of Commerce) and OECD (Organization for Economic Cooperation and Development). AAK has been a member of the UNGC since 2002.

In 2015, all member states of the United Nations adopted 17 goals – the Sustainable Development Goals (SDGs) – setting out to end poverty, protect the planet, and ensure SURVSHULW\IRUDOO(DFKJRDOKDVVSHFL¿FWDUJHWVWREH achieved by 2030. As a global company AAK recognizes that businesses have to play an important role in that process and we have decided to include the SDGs in our model. AAK will further develop ways to support the process and monitor and report on our progress.

CSR policies and codes

AAK's CSR policies and codes are based on the UNGC as well as on our own principles, and are implemented globally for all AAK business activities. The policies and codes are aligned with many of our customers' requirements and values, which strengthen our strategic alignment. AAK's policies and codes are available at our website.

\$\$.¶V³+RXVHRI6XVWDLQDELOLW\´

Five CSR focus areas

:HKDYHGH¿QHG¿YH&65IRFXVDUHDV±WKHµSLOODUV¶±WKDW are important to our business. They provide an overview and JXLGHXVLQVHWWLQJREMHFWLYHVDQGIRFXVRXUUHVRXUFHV

Our Customers covers all areas in which AAK interacts with customers. It includes products, product development, food safety, product information, and market communication. Interaction with customers is based on sound business ethics and a deep understanding of the company's responsibility for safeguarding customer brands. As a supplier of ingredients for some of the world's best-known brands, AAK recognizes its role and its customers' expectations and see these as key elements in the way the AAK company strategy is executed.

Our Suppliers covers activities related to the sourcing of raw materials that AAK uses in its production plants. Sustainable sourcing of raw materials is the backbone of AAK's business and a key element in our strategy. The combination of the right raw materials and our co-development approach is key to the wide range of solutions offered. Just as it is vital for AAK to obtain the right raw materials, AAK places equal emphasis on how our raw materials are produced. For this reason AAK has implemented a Supplier Code of Conduct that, among others, applies to all AAK's direct raw material suppliers worldwide.

Since 2014 AAK has used e-learning as a supplement for global training of our front-line employees. Courses such as anti-corruption, competition law, and sustainable palm and shea oil have proven to be very effective and AAK will continue to utilize this tool.

We have continuously focused on safety in the workplace. Through the work of our Global Safety 7HDPDQGORFDOLQLWLDWLYHVZRUNUHODWHGLQMXULHVKDYH GHFOLQHGVLJQL¿FDQWO\RYHUWKH\HDUV

Our Planet

Our People

Our Neighbours

This focus area covers AAK's impact on the environment in terms of consumption and emissions from our production plants. It is a top priority for us to minimize our use of natural UHVRXUFHVDQGHPLVVLRQVSHUSURFHVVHG¿QDOSURGXFWHYHQ though our stronger focus on speciality drives a higher degree of processing. We have over the years been able to create good improvement within areas such as GHG emissions, water consumption and waste treatment. In our Sustainability Report you can read about various local initiatives.

This focus area is about working life at AAK: how to remain an attractive workplace for employees, and to make sure that everybody is healthy and safe. AAK's employees are the company's most important resource. With employees in many different locations across the globe – in production SODQWVVDOHVRI¿FHVDQGVRXUFLQJRSHUDWLRQV±\$\$.LVD GLYHUVHFRPSDQ\ZLWKPDQ\GLIIHUHQWMREIXQFWLRQV&RPmon to every employee is the company's values and Code of Conduct, which govern the way in which our business is conducted and how employees interact with each other and the company's stakeholders.

This focus area covers activities that AAK initiates and engages in, be they local, regional, national or inter national, in order to play our part and act responsibly in society. Contributing to, and being part of, the community in which AAK operates is essential for maintaining a positive relationship with neighbours, politicians and authorities. Which community activities we engage in is dependent on what is relevant and adds most value to the local community. Through a commitment to community causes, AAK is also instrumental in creating a workplace with highly motivated employees who take pride in working for a company that makes a noticeable difference.

&65REMHFWLYHVDQG*5,

7RPDLQWDLQPRPHQWXPDQGGULYHLPSURYHPHQWZHGH¿QH REMHFWLYHVZLWKLQHDFKRIWKH¿YHIRFXVDUHDV\$FKLHYH-PHQWVDQGIXWXUHREMHFWLYHVDUHSXEOLFO\DYDLODEOHLQRXU Sus tainability Report. Further, based on the Global Reporting Initiative (GRI) G4 guidelines we globally monitor indicators of importance to our stakeholders and ourselves. To identify indicators of importance we use the materiality analysis methodology outlined in G4.

Global CSR team

The engine behind all of our CSR activities is our decentralized global CSR team, established in 2007. It consists of local CSR teams possessing competencies covering our CSR scope. The Global CSR Manager reports to the &02&KLHI0DUNHWLQJ2I¿FHU?ZKRLVDPHPEHURI\$\$.¶V Executive Committee.

Sharing and partnerships

6KDULQJRXUNQRZOHGJHREMHFWLYHVDQGDFKLHYHPHQWVZLWK our stakeholders is a fundamental part of our approach. In our annual Sustainability Report we share global information based on the GRI framework supported by a variety of local SURMHFWVDQGLQLWLDWLYHVLOOXVWUDWLQJKRZRXUVWUDWHJ\EHFRPHV DOLYH6SHFL¿FDOO\ZHRIIHUWRVKDUHHWKLFDOLQIRUPDWLRQZLWK customers via the Sedex platform. Further, we frequently report progress on the implementation of our palm oil policy in AAK's Progress Report on Sustainable Palm Oil. Reports and policies are publically available at AAK's website.

The UN Global Compact encourages companies to engage in partnerships to tackle global challenges more effectively. AAK embraces the view that in partnerships you combine competencies and are more likely to accomplish more than you could do on your own. Partnering with other businesses, NGOs and governmental agencies are ways to accomplish more. To name a few examples, AAK is participating in or partnering with RSPO (Roundtable on Sustainable Palm Oil), GSA (Global Shea Alliance), Proforest, Danida in Denmark, and the British organization TREE AID.

Monitoring and dialogue

2XU&65V\VWHPLVQRWVWDWLFDGMXVWLQJLQVWHDGWRLQSXW from stakeholders such as customers, investors, NGOs and employees. We monitor new and upcoming legislation, follow trends in our communities, and benchmark our CSR practices against those of retailers, customers, and competitors.

2XURYHUDOOREMHFWLYHLVWRJURZ\$\$.VXVWDLQDEO\DQG progress within sustainability as a whole. If you would like to learn more about our CSR achievements, initiatives and REMHFWLYHVSOHDVHUHIHUWRRXUDQQXDO6XVWDLQDELOLW\5HSRUW Our next report is expected to be released during the second quarter 2017 and will be made available on our website.

With another good AAK year behind you, how would you GHVFULEHWKHFRPSDQ\¶V¿QDQFLDOSHUIRUPDQFH"

I would describe it as solid, no doubt. We have now been able to deliver 24 straight quarters with record-high operating SUR¿WTXDUWHURYHUTXDUWHUDVZHOODVDUHFRUGKLJKIXOO\HDU result every year since 2010. This is a quite impressive track record.

The organic growth for our speciality and semi-speciality VROXWLRQVFRQWLQXHGGXULQJDQGZHKDYHGH¿QLWHO\ JDLQHGPDUNHWVKDUHV:HKDYHDOVRLGHQWL¿HGWKHGULYHUV for further organic growth and continued our effective cost control with annual productivity improvements.

Fredrik Nilsson, CFO: No reasons to lower ambition level

\$IWHUDYHU\VWURQJFDVKÀRZLQZHKDYHVHHQDQ RXWÀRZIURPZRUNLQJFDSLWDOLQPDLQO\GXHWRVLJQL¿ cantly higher raw material prices. As a consequence of the organic growth, we have also tied up more working capital in accounts receivables. Our focus on working capital days continues and some further minor improvements should be possible, particularly to improve payment terms with our suppliers.

The Group's capital expenditure continued to be at a high OHYHOGXHWRRXUWZRJUHHQ¿HOGSURMHFWVLQ%UD]LODQG&KLQD We furthermore acquired California Oils Corporation on the US West Coast – a very strategic acquisition in order for us to be a national player in the US. For 2017, we expect capital expenditure to be another year above historic levels, but clearly below 2016.

)RUWKH¿IWK\HDULQDURZ\$\$.LQFUHDVHGWKHGLYLGHQGSDLG AAK strives to pay a stable dividend linked to the company's long-term performance. Total paid dividend was SEK 328 PLOOLRQRUSHUFHQWRIWKHFRQVROLGDWHGSUR¿WDIWHUWD[

With your company program AAKtion now completed, what ambition level for the coming years can we expect?

Our former management ambition was launched in 2010, DLPLQJWRGRXEOHRXURSHUDWLQJSUR¿WIURP6(.PLOOLRQ WR6(.PLOOLRQH[FOXGLQJDFTXLVLWLRQVDQGDW¿[HG FX. With some support from acquisitions and positive FX we reached that target by the end of 2016. The average annual improvement year-over-year H[FOXGLQJDFTXLVLWLRQVDQGDW¿[HG);KDVEHHQ 10 percent since 2010.

The activity levels in our company programs AAK Acceleration and AAKtion have been high and combined with our solid foundation and supported by very strong business drivers we see no reasons to lower the ambition level for the coming years. We expect, on average, a 10 percent year-over-year LPSURYHPHQWLQRSHUDWLQJSUR¿WZKLFK will support a good and consistent improvement in earnings per share. Our new company program, The AAK Way, will guide us up through 2019. Our key focus with the program is to enable the company to continue to deliver strong organic growth. This will be achieved by IRFXVLQJRQ¿YHSULRULW\DUHDV*RWR Market, Operational Excellence, Special Focus Areas, Innovation, and People.

Reasons to invest in AAK

The underlying global growth in the segments in which AAK is present is normally in line with global GDP growth. AAK has in the past been able to grow faster than the underlying markets in our focus areas – speciality and semi-speciality solutions in Food Ingredients and Chocolate & Confectionery Fats – despite not having a fully global footprint. With our JUHHQ¿HOGLQYHVWPHQWVDQGRXUODWHVWDFTXLVLWLRQVLQJURZWK markets, we have strengthened our footprint and become a truly global company. Our ambition is to continue to grow faster than the underlying markets.

'HVSLWHFRQVLGHUDEOHJUHHQ¿HOGLQYHVWPHQWVZHKDYH over recent years built a very strong balance sheet with an improved equity ratio. Combined with long-term loan agreements this has created a solid foundation for further growth, both organically and through selective and strategic acquisitions.

AAK has an important geographical footprint in regions where both population and urbanization is increasing – demographic changes that open up substantial market opportunities. We are furthermore strongly supported by our customer value propositions for health and reduced costs and our customer product co-development and solutions approach.

Between 2010 and 2016 AAK has annually increased its RSHUDWLQJSUR¿WE\SHUFHQWRQDYHUDJHDW¿[HGIRUHLJQ exchange rates and excluding acquisitions). Including acquisitions and positive currency translation differences, RSHUDWLQJSUR¿WKDVLQFUHDVHGSHUFHQWRQDYHUDJH%DVHG on our high activity within sales, customer innovation and new product development, and based on the very solid foundation we have built and our strong executive and local management, we see no reason to lower that ambition for the coming years.

\$\$.¶VRSHUDWLQJSUR¿WSHUTXDUWHU±

Above the market growth Very strong underlying growth drivers

Strong balance sheet supporting further growth Average 10 percent year-over-year operating SUR¿WLPSURYHPHQWIRUWKHFRPLQJ\HDUV

Board of Directors

Melker Schörling Chairman of the Board of Directors Elected in: 2005 (Karlshamns AB 2001)

Born: 1947 Nationality: Swedish

Main occupation: Chairman of the Board of

Directors of Melker Schörling AB Qualifications: BSc. in Economics and Business Administration

Professional background: CEO of a number of companies, including Securitas AB 1987–1992 and Skanska AB 1993–1997

Other directorships: Chairman of the Board of Directors of Hexagon AB and HEXPOL AB. Member of the Board of Directors of Hennes & Mauritz AB

Holdings in AAK: Melker Schörling AB holds 13,899,301 shares in AAK

Arne Frank Elected in: 2010 Born: 1958 Nationality: Swedish Main occupation: President and CEO AAK AB

Qualifications: MSc. Industrial Engineering and Management

Professional background: Chairman, CEO and President of TAC, Executive VP of Building Automation Business Unit at Schneider Electric SA, Chairman and CEO of Carl Zeiss Vision Holding GmbH

Other directorships: Member of the Board of Directors of Alfa Laval AB, Chairman of the Board of Directors of Inwido AB

Holdings in AAK: 346,550 shares (together with family through own company)

Ulrik Svensson* Elected in: 2007 Born: 1961 Nationality: Swedish Main occupation: CEO Melker Schörling AB until December 31, 2016 Qualifications: BSc. in Economics and Business Administration

Professional background: CFO of several listed companies, including Swiss International Airlines and Esselte

Other directorships: Member of the Board of Directors of Assa Abloy AB, HEXPOL AB, Loomis AB, Hexagon AB and Flughafen Zürich AG

Holdings in AAK: None

*Resigned from the Board of Directors on December 31, 2016.

0HPEHUVRIWKH%RDUGRI'LUHFWRUVDSSRLQWHGE\WKHHPSOR\HHV

Leif Håkansson

AAK Sweden AB Appointed by IF-Metall Elected in: 2005 Born: 1957 Nationality: Swedish Main occupation: Senior positions in trade unions and local and regional government and board work Qualifications: Electrical engineering Holdings in AAK: None

Annika Westerlund

AAK Sweden AB Appointed by PTK-L Elected in: 2005 Born: 1956 Nationality: Swedish Main occupation: Laboratory Assistant Qualifications: Technical College Holdings in AAK: None

30

Marianne Kirkegaard Elected in: 2015 Born: 1968 Nationality: Danish Main occupation: CEO CSM Qualifications: MBA in International Trade, \$DUKXV+DQGHOVK¡MVNROHDQGH0%\$6,0, Copenhagen, Denmark Professional background: Various positions at Unilever and Carlsberg Other directorships: Member of the Board of Directors of Dansk Supermarked Holdings in AAK: 670 shares

Märta Schörling Andreen Elected in: 2013 Born: 1984 Nationality: Swedish Main occupation: Melker Schörling AB Qualifications: MSc. in Business and Economics Professional background: Strategy consultant Pond Innovation & Design Other directorships: Member of the Board of Directors of Melker Schörling AB and HEXPOL AB Holdings in AAK: None

Lillie Li Valeur Elected in: 2013 Born: 1970 Nationality: Danish Main occupation: Vice President in Arla Foods amba, responsible for Global Milk-based Beverages Business Unit Qualifications: MBA and BSc. in Medicine Professional background: General management, strategy and business development; global and Asia market expertise; Food, ingredients, pharmaceutical and consultancy industry experience; B2C and B2B commercial background with Novartis, Arla Foods and Bain & Co. Other directorships: Member of the Board of Directors of Meda AB Holdings in AAK: 500 shares

Auditor

Sofia Götmar-Blomstedt PricewaterhouseCoopers AB Born: 1969 Authorized public accountant Auditor in charge The company's auditor since 2013

31

Executive Committee

Arne Frank President and CEO AAK AB Born: 1958 Elected in: 2010 Nationality: Swedish Qualifications: MSc. Industrial Engineering and Management Holdings in AAK: 346,550 shares (together with family through own company)

David Smith President European Supply Chain Vice President AAK AB Born: 1960 Employed: 2001 Nationality: British Qualifications: MBA, Graduate Diploma in Business Management Holdings in AAK: None

Fredrik Nilsson Chief Financial Officer (CFO) including Corporate Communications Vice President AAK AB Born: 1977 Employed: 2007 Nationality: Swedish Qualifications: MSc. Business Administration Holdings in AAK: 15,000 shares

Torben Friis Lange President AAK Asia Vice President AAK AB Born: 1963 Employed: 2010 Nationality: Danish Qualifications: BSc. Dairy Technology, Graduate Diploma in Business Administration Holdings in AAK: 100,000 shares

Jan Lenferink President AAK Europe Vice President AAK AB

Born: 1963 Employed: 2015 Nationality: Dutch

Qualifications: Food Technology Holdings in AAK: None

Terrence W. Thomas President AAK USA and Canada Vice President AAK AB Born: 1962 Employed: 2013 Nationality: American Qualifications: MBA, BSc. Chemical Engineering Holdings in AAK: 20,000 shares

Octavio Díaz de León

President AAK North Latin America Vice President AAK AB Born: 1967 Employed: 2007 Nationality: Mexican Qualifications: MBA, BSc. Mechanical & Electrical Engineering Holdings in AAK: 40,000 shares

Anne Mette Olesen Chief Marketing Officer (CMO) including CSR Vice President AAK AB Born: 1964 Employed: 2010 Nationality: Danish Qualifications: MBA, BSc. Chemical Engineering Holdings in AAK: 60,000 shares

Gerardo Garza López de Hereida

President AAK South Latin America Vice President AAK AB Born: 1961 Employed: 2014 Nationality: Mexican Qualifications: Graduate Diploma in Business Administration, Food Engineering Holdings in AAK: None

Renald Mackintosh Chairman Special Nutrition Vice President AAK AB Born: 1951 Employed: 2002 Nationality: Dutch Qualifications: MSc. Food Technology Holdings in AAK: 28,300 shares

René Schou President Foodservice Europe Vice President AAK AB Born: 1969 Employed: 2011 Nationality: Danish Qualifications: MBA, and Food Technology Holdings in AAK: None

Karsten Nielsen Chief Technology Officer (CTO) Vice President AAK AB Born: 1963 Employed: 1988 Nationality: Danish Qualifications: Graduate Diploma in Food Technology Holdings in AAK: 15,264 shares

Jens Wikstedt President SB&N including HR Vice President AAK AB Born: 1958 Employed: 2014 Nationality: Swedish Qualifications: BSc. Economics and Business Administration Holdings in AAK: 1,000 shares

AAK's Glossary

  • Akonino® AAK brand name for vegetable oil blends optimized to meet the nutritional requirements of infants and thus used as an ingredient in infant nutrition and follow-on formulations.
  • Amino acids Carboxyl acids containing an amino group; building block for proteins.
  • Bypass fats Fats that have been tailored to bypass the rumen of ruminants, which means that a larger amount of fat and energy is left intact for high-yielding dairy cows.
  • CBA (Cocoa Butter Alternatives) Fats with physical properties similar to those of cocoa butter, i.e. solid at room temperature and with very rapid melt-off in the mouth.
  • CBE (Cocoa Butter Equivalents) A type of CBA which is chemically identical to cocoa butter, and which, according to national standards in many areas, among others the European Union, may be used in chocolate. Manufactured from exotic raw materials, including shea oil.
  • CBI (Cocoa Butter Improver) A vegetable fat which by partly replacing cocoa butter in a chocolate, improves the properties of the cocoa butter in the chocolate – in most cases by improving the heat stability of the final chocolate.
  • CBR (Cocoa Butter Replacer) CBA with properties similar to those of cocoa butter. Used in such things as chocolate coatings for cookies and biscuits. More user-friendly than CBE as no tempering is required.
  • CBS (Cocoa Butter Substitutes) CBA with physical properties and application areas similar to those of CBR. Commonly based on a lauric raw material.
  • Cocoa butter Fat extracted by crushing cocoa beans. Its composition lends chocolate its unique properties.
  • Crystallization The solidification process of an oil, the process going from the liquid (oil) phase to the crystal (fat/solid) phase.
  • Fatty acids Long-chain carboxyl acids. In vegetable oils, the most common fatty acids consist of 12 to 18 carbon atoms.
  • Glycerine A highly viscous, flavorless trivalent alcohol (chemical component with three alcohol groups) forming the backbone of a triglyceride when esterified with three fatty acids.
  • +\GURJHQDWLRQ The process of adding hydrogen to the oil to saturate the double bonds in mono- or polyunsaturated fatty acids.
  • InFat® A speciality fat for infant formulas.

  • Lipids A collective name for a wide range of natural products, which include fats & oils.

  • Monounsaturated fat Popular name for monounsaturated fatty acids. Fat with only one double bond along the carbon chain.
  • Monounsaturated fatty acids Fatty acids with one double bond in the carbon chain.
  • Nutrition Food, the process of taking in and absorbing nourishment.
  • Oleochemicals A common name for chemicals derived from vegetable oils and fats. Oleochemicals have numerous applications in the chemical and pharmaceutical industries, where they often substitute petrochemicals and similar components based on mineral oils.
  • Omega-3 Polyunsaturated fatty acids in which the first double bond is located three carbon atoms from the end of the carbon chain.
  • Omega-6 Polyunsaturated fatty acids in which the first double bond is located six carbon atoms from the end of the carbon chain.
  • Polyunsaturated fatty acids Fatty acids with two or more double bonds in the carbon chain.
  • Rheological properties Flow properties, viscosity. Describe the force it takes to make a material (semi-liquid or solid) to change its form.
  • Saturated fats Popular name for saturated fatty acids.
  • Saturated fatty acids Fatty acids which do not contain double bonds in the carbon chain.
  • Surfactants A substance which is soluble in different materials, for example water and oil, therefore they are active on the surface of particles and help mixing components which are normally not mixable.
  • Trans fats Popular name for fats containing trans fatty acids.
  • Trans fatty acids Unsaturated fatty acids with a different kind of double bond than those naturally occurring in vegetable oils.
  • Unsaturated fats Fats containing mono- and polyunsaturated fatty acids, a popular name for mono- and polyunsaturated fatty acids.

)LQDQFLDO LQIRUPDWLRQ

Page
Directors' Report 37
Consolidated Income Statement 41
Consolidated Statement of Comprehensive Income 41
Consolidated Balance Sheet 42
Consolidated Changes in Shareholders' Equity 44
Consolidated Cash Flow Statement 45
Income Statement – Parent Company 46
Statement of Comprehensive Income – Parent Company 46
Balance Sheet – Parent Company 47
Changes in Shareholders' Equity – Parent Company 48
Cash Flow Statement – Parent Company 49
Notes 50
Alternative Performance Measures 77
Corporate Governance Report 79
Auditor's report 85
The AAK share 88
'H¿QLWLRQV 90
Financial Calendar, Annual General Meeting 91

All amounts are denominated in SEK million unless otherwise stated.

Contents

Directors' Report

)RUWKH¿QDQFLDO\HDU-DQXDU\±'HFHPEHU

7KH%RDUGRI'LUHFWRUVDQGWKH&KLHI([HFXWLYH2I¿FHURI\$\$.\$% (publ.), corporate identity number 556669-2850, with its registered RI¿FHLQ0DOP|KHUHE\SUHVHQWWKH)LQDQFLDO6WDWHPHQWVDQG &RQVROLGDWHG)LQDQFLDO6WDWHPHQWVIRUWKH¿QDQFLDO\HDU-DQXDU\ – December 31, 2016.

3HUIRUPDQFHDQG¿QDQFLDOSRVLWLRQ

  • We are proud to report that our decisive, targeted, hard work, based on our clear strategy, has produced good results. 7KHRSHUDWLQJSUR¿WZDVDWDUHFRUGKLJKOHYHORQFHDJDLQ \$OWKRXJKSDUWVRIWKHZRUOGPDUNHWDUHIDFLQJVLJQL¿FDQW challenges, the Group continued to report a double-digit LPSURYHPHQWLQSUR¿WFRPSDUHGWRWKHSUHYLRXV\HDU7KLV is a trend that has continued since 2010.
  • Net sales increased by SEK 1,943 million to SEK 22,057 million (20,114). This increase was due primarily to a better product mix, higher raw material prices and acquisitions, but was mitigated in part by a negative currency translation effect of SEK 648 million. Volumes increased by 7 percent, primarily due to the acquisitions made. Organic growth amounted to 2 percent, despite lower volumes for commodity products in Food Ingredients, which showed exceptional growth in 2015.
  • 2SHUDWLQJSUR¿WH[FOXGLQJQRQUHFXUULQJLWHPVZDVDWD record high of SEK 1,615 million (1,411), an improvement of 14 percent. The currency translation effect was negative and DPRXQWHGWR6(.PLOOLRQ?2SHUDWLQJSUR¿WWUDQVODWHG DW¿[HGH[FKDQJHUDWHVH[FOXGLQJQRQUHFXUULQJLWHPVLP proved by 17 percent. All business areas had a double-digit SHUFHQWDJHLPSURYHPHQWLQRSHUDWLQJSUR¿WLQFRPSDUHG to the previous year.
  • 2SHUDWLQJSUR¿WLQFOXGLQJQRQUHFXUULQJLWHPVDPRXQWHGWR SEK 1,615 million (1,409), an improvement of 15 percent. Non-recurring items amounted to SEK 0 million (-2) and consist of acquisition-related expenses of SEK 15 million (15) and a positive net effect of SEK 15 million concerning the acquisition of California Oils Corporation.
  • 2SHUDWLQJSUR¿WSHUNLORH[FOXGLQJWKHDERYHQRQUHFXUULQJ items, amounted to SEK 0.82 (0.77). This was due to an improved product mix but was mitigated by a negative currency translation effect and expenses in connection with new investments.
  • 7KH*URXS¶VSUR¿WDIWHU¿QDQFLDOLWHPVDPRXQWHGWR6(. PLOOLRQ?1HW¿QDQFLDOLWHPVZHUH6(.PLOOLRQ (-114), an increase of SEK 56 million due to an increase in the Group's loans in high-interest rate countries as a consequence of ongoing new investments and recent acquisitions, plus increased working capital on account of higher raw material prices. The equity/assets ratio was 44 percent as at December 31, 2016 (48 percent as at December 31, 2015). Consoli dated net debt as at December 31, 2016 was SEK 2,620 million (SEK 2,083 million as at December 31, 2015). On December 31, 2016, the Group had total credit facilities of around SEK 6,139 million.

  • &DVKÀRZIURPRSHUDWLQJDFWLYLWLHVEHIRUHFKDQJHVLQZRUNLQJ capital, amounted to SEK 1,476 million (1,356). Working capital increased by SEK 263 million (reduction of SEK 380 million), primarily as a consequence of higher raw material prices combined with the working capital tied up in new investments. &DVKÀRZIURPRSHUDWLQJDFWLYLWLHVLQFOXGLQJFKDQJHVLQ working capital, amounted to SEK 1,213 million (1,736). After LQYHVWPHQWVLQFOXGLQJDFTXLVLWLRQVFDVKÀRZDPRXQWHG to SEK -208 million (720).

  • The Group's net investments in non-current assets and acquisitions totalled SEK 1,421 million (1,016), comprising ongoing maintenance and growth investments, and acquisitions in the USA and acquisitions of non-controlling interests in Mexico, plus strategic investments in Brazil and China.
  • Return on Capital Employed, calculated on a rolling 12 months basis, amounted to 15.8 percent (15.7 percent on December 31, 2015). This was despite the negative impact of higher working capital as a consequence of higher raw material prices, new investments and acquisitions.
  • Earnings per share before dilution were SEK 23.71 (22.17), an increase of 7 percent.
  • The proposed dividend amounts to SEK 8.75 (7.75), an increase of SEK 1.00 or 13 percent.

The Company's largest business area, Food Ingredients, reported DUHFRUGRSHUDWLQJSUR¿WRI6(.PLOOLRQ?DQLQFUHDVHRI SHUFHQW7KHRSHUDWLQJSUR¿WSHUNLORLQFUHDVHGE\SHUFHQWWR SEK 0.75 (0.72). This was due to an improved product mix but was mitigated by a negative currency translation effect and expenses in connection with new investments. The Bakery segment had yet another challenging year, particularly in Western Europe. The Dairy segment reported strong organic volume growth. Butterfat prices have been at a very low level for a number of quarters but have risen dramatically since the summer. The Special Nutrition segment, which comprises Infant Nutrition, Senior Nutrition and Medical Nutrition, reported high volume growth, which is due to exceptional volume growth for the Akonino ® product range in Infant Nutrition. Our other product range in Infant Nutrition is InFat ®, ZKLFKLVVROGYLD\$GYDQFHG/LSLGV\$%DMRLQWYHQWXUHEHWZHHQ AAK and Enzymotec. This product segment reported good volume growth combined with an improved product mix. Foodservice reported organic volume growth that was particularly good in the UK and the USA. There was negative volume growth for commodity products, after exceptional growth in 2015.

Chocolate & Confectionery Fats reported a strong improvement LQRSHUDWLQJSUR¿WRISHUFHQWWR6(.PLOOLRQ?SULPDULO\ as a consequence of strong volume growth. Volumes increased E\SHUFHQWDQGDIWHUWZR\HDUVRIVLJQL¿FDQWO\SRRUHUPDUNHW conditions in Ukraine and Russia, both countries showed strong growth. The volumes for both high and low value-adding products continued to grow organically, and the volume growth for low value-adding products was particularly good during the second half of the year. The strong product development of recent years

Acquisition of non-controlling interests in AAK Mexico During the third quarter, AAK acquired 4.5 percent of a noncontrolling interest in AAK Mexico from United Plantation Berhad. After the acquisition, AAK holds more than 99 percent of the shares in AAK Mexico.

Strategic investments in China and Brazil

7KHQHZIDFWRU\LQ%UD]LOEHJDQRSHUDWLRQVLQWKH¿UVWKDOIRI The work to build a new factory in China is proceeding according to SODQDQGWKH¿UVWYROXPHVDUHH[SHFWHGWREHGHOLYHUHGGXULQJWKH ¿UVWTXDUWHURI

Board changes

In October 2016, Melker Schörling announced that he would resign IURPKLVRI¿FHDV&KDLUPDQRIWKH%RDUGRI'LUHFWRUVRI\$\$.\$% (publ.) at the Annual General Meeting on May 17, 2017. Melker Schörling will continue to support and advise AAK's management and Board of Directors. Ulrik Svensson left his position as CEO of Melker Schörling AB on December 31, 2016 and resigned from his RI¿FHDVDPHPEHURIWKH%RDUGRI'LUHFWRUVRI\$\$.\$%SXEO?DW the same time.

Financial goals

\$\$.¶V¿QDQFLDOJRDOVDUHWRJURZIDVWHUWKDQWKHXQGHUO\LQJPDUNHW DQGWRJHQHUDWHVWURQJFDVKÀRZV:HDOVRLQWHQGWRFRQWLQXDOO\ improve the return on operating capital.

Planned dividend policy

7KHREMHFWLYHRIWKH%RDUGRI'LUHFWRUVWDNLQJLQWRDFFRXQWWKH GHYHORSPHQWRI*URXSHDUQLQJVLWV¿QDQFLDOSRVLWLRQDQGIXWXUH development opportunities, is to propose annual dividends HTXLYDOHQWWRDWOHDVW±SHUFHQWRIWKHSUR¿WIRUWKH\HDU after tax, for the Group.

Concluding comments by the President

"Based on AAK's customer value propositions for health and reduced costs, and our customer product co-development and solutions approach, we continue to remain prudently optimistic about the future. The main drivers are the continued positive underlying development in Food Ingredients and the continued LPSURYHPHQWLQ&KRFRODWH &RQIHFWLRQHU)DWV´

1RPLQDWLRQ&RPPLWWHH

Ahead of the 2017 Annual General Meeting, the Nomination Committee has proposed that Mikael Ekdahl be elected as the new Chairman of the Board of Directors and that Gun Nilsson and Bengt Baron be elected as new Board members. The Nomination Committee has also proposed the re-election of Arne Frank, Lillie Li Valeur, Märta Schörling Andreen and Marianne Kirkegaard as Board members. In total, the Nomination Committee represents approximately 48.0 percent of the shares and votes in AAK as at December 31, 2016.

AAK's Nomination Committee for the 2017 Annual General Meeting consists of:

  • Mikael Ekdahl (chairman), Melker Schörling AB (publ.)
  • Lars-Åke Bokenberger, AMF Fonder
  • Henrik Didner, Didner & Gerge Fonder
  • Johan Strandberg, SEB Investment Management

in close collaboration with customers, innovative new solutions and greater geographical presence continue to produce positive UHVXOWV2SHUDWLQJSUR¿WSHUNLORURVHIURP6(.WR6(. as a consequence of this.

2SHUDWLQJSUR¿WIRUWKH&RPSDQ\¶VVPDOOHVWEXVLQHVVDUHD Technical Products & Feed, was SEK 100 million (88), an increase of 14 percent. This is primarily due to the positive growth in fatty DFLGVWKDWLVEHKLQGWKHLPSURYHPHQWLQSUR¿W

2SHUDWLRQVDQGVLJQL¿FDQWHYHQWV

Business areas

The Company's business areas are Food Ingredients, Chocolate & Confectionery Fats and Technical Products & Feed. Group-wide functions are included in the Group Functions segment.

Food Ingredients maintains its strong regional positions, primarily in Europe, the USA and North Latin America, but is gradually strengthening its positions in other regions. Acquisitions were made in the USA during the year.

Chocolate & Confectionery Fats and Personal Care have worldleading positions, and these will gradually be expanded in an increasingly global arena.

Technical Products & Feed has a strong local position in Northern Europe and will continue to focus its growth efforts in these geographical segments through its close links to the .DUOVKDPQIDFWRU\LQ6ZHGHQEULQJLQJVLJQL¿FDQWV\QHUJ\JDLQV

New company program and new management ambition 7KHFRPSDQ\SURJUDP³\$\$.WLRQ´IRU±ZDVHQGHGGXULQJ the year and developed well during its three years. The new com-SDQ\SURJUDP³7KH\$\$.:D\´ZLOOJXLGHRSHUDWLRQVXSWRWKHHQG of 2019. Our primary focus for the program is that AAK must be able to further increase its organic growth. This will be achieved E\PHDQVRI¿YHSULRULW\DUHDV³*RWR0DUNHW´³2SHUDWLRQDO ([FHOOHQFH´³6SHFLDO)RFXV\$UHDV´³,QQRYDWLRQ´DQG³3HRSOH´ Parallel to the new company program, a new management ambition has been presented for the years to come. The ambition is WRLQFUHDVHRSHUDWLQJSUR¿WE\SHUFHQWSHUDQQXPRQDYHUDJH via organic growth, innovation, an improved product mix and HQKDQFHGHI¿FLHQF\

Acquisitions in the USA

In July, AAK acquired California Oils Corporation, the leading company in speciality and semi-speciality oils on the US West Coast, from Mitsubishi Corporation of Japan. The company has an annual volume of approximately 110,000 MT and had sales of approxi-PDWHO\6(.PLOOLRQLQWKHODVW¿QDQFLDO\HDU7KHFRPSDQ\ has 65 employees.

The acquisition had very limited impact on AAK's operating SUR¿WIRUDQGWKLVDFTXLVLWLRQFRQVHTXHQWO\KDGDGLOXWLYH HIIHFWRQWKHRSHUDWLQJSUR¿WSHUNLORIRU7KHDFTXLVLWLRQZDV completed on August 31, 2016, and the entity was consolidated from September 1. The acquisition will start to contribute to AAK's RSHUDWLQJSUR¿WGXULQJWKHWKLUGTXDUWHURI7KHFDOFXODWLRQ of the fair value of the assets and liabilities of California Oils Corporation resulted in negative goodwill of SEK 135 million. At the same time, planned integration expenses of SEK 120 million were recognized as expenses, resulting in positive non-recurrent income of SEK 15 million being recognized in the fourth quarter.

SODQWVZLWKDSSURSULDWHRI¿FLDOSHUPLWVLQDOOFRXQWULHVLQZKLFKZH operate. In Sweden, the operations in Karlshamn are licensable under Swedish law.

Employees

The recruitment of skilled and competent personnel is an important component in maintaining competitiveness for the AAK Group. The Group therefore has continuous active programs for personnel development.

Risk management and sensitivity analysis

All business operations involve risk – a controlled approach to ULVNWDNLQJLVDSUHUHTXLVLWHIRUPDLQWDLQLQJJRRGSUR¿WDELOLW\ Risks may depend on events in the operating environment and may affect a certain sector or market. A risk may also be purely FRPSDQ\VSHFL¿FRUFRXQWU\VSHFL¿F\$W\$\$.HIIHFWLYHULVN management is a continual process which is conducted within the framework of operational management and forms a natural part of the day-to-day monitoring of operations.

For more detailed information, please refer to the section on Risks on page 22 and to Note 3, Financial Risk Management.

External risks

7KH\$\$.*URXSLVH[SRVHGWRWKH¿HUFHFRPSHWLWLRQZKLFK FKDUDFWHULVHVWKHLQGXVWU\UHODWHGWRÀXFWXDWLRQVLQUDZPDWHULDO prices which affect capital tied up.

Operational risk

The raw materials used in operations are agricultural products, and availability may therefore vary due to climatic and other external factors.

Financial risk

7KH*URXS¶VPDQDJHPHQWRI¿QDQFLDOULVNVLVGHVFULEHGLQ1RWH Financial Risk Management.

Corporate Governance Report

For information on the composition and work, etc., of the Board of Directors, see the Corporate Governance Report on page 79.

Parent

The Company is the holding company of the AAK Group, and its DFWLYLWLHVFRQVLVWPDLQO\RIMRLQW*URXSIXQFWLRQVFRQQHFWHGWRWKH development and management of the Group. The Parent employs personnel with skills and competencies to execute group-wide ¿QDQFLQJDFFRXQWLQJLQIRUPDWLRQKXPDQUHVRXUFHVDQG,77KH Parent is also responsible for Group strategy and risk management, and provides legal and tax-related services to Group companies. The costs of Group Functions have increased, primarily on account of research and development initiatives. This innovation initiative is an important part of both the company program recently ended and the new program, The AAK Way.

The Parent's invoicing in 2016 amounted to SEK 95 million ?7KHSUR¿WDIWHU¿QDQFLDOLWHPVDPRXQWHGWR6(.PLOOLRQ (1). Interest-bearing liabilities minus cash and cash equivalents and interest-bearing assets were SEK -1,301 million (-1,007). Investments in intangible non-current assets and property, plant and equipment amounted to SEK 5 million (4). The Parent had a total of 31 (29) employees on December 31, 2016.

1RVLJQL¿FDQWHYHQWVKDYHRFFXUUHGDIWHUWKHHQGRIWKHUHSRUWLQJ period.

Share capital and shareholder structure

The total number of shares in AAK as at December 31, 2016 was 42,288,489. There is one class of shares in AAK, and each share entitles the holder to one vote. There are no limits as regards how many votes each shareholder may cast at an Annual General Meeting. Nor are there any limitations regarding the transfer of the shares resulting from provisions in law or in the Articles of Association.

Of the Company's shareholders, only Melker Schörling AB (publ.) has a shareholding which represents at least one-tenth of the number of votes of all shares in AAK. Melker Schörling AB (publ.)'s shareholding as at December 31, 2016 amounted to 32.9 percent of the shares and votes.

AAK is not aware of any agreement between direct shareholders of AAK that would involve limitations in the right to transfer shares. The shareholder structure is described further in the section on the AAK Share, pages 88–89.

Articles of Association

The Articles of Association stipulate that Board members shall be appointed by the Annual General Meeting of AAK. The Articles of Association contain no provisions regarding dismissal of Board members or regarding amendment of the Articles of Association.

Important agreements affected by change in control UHVXOWLQJIURPRI¿FLDOWDNHRYHUELG

7KH*URXS¶VORQJWHUP¿QDQFLQJDJUHHPHQWFRQWDLQVVWLSXODWLRQV that, in certain cases, give the lender the right to request advance payment if control of AAK changes substantially. Such a substantial FKDQJHLQFRQWUROFDQRFFXUDVDUHVXOWRIDQRI¿FLDOWDNHRYHUELG

AAK's assessment is that it has been necessary to accept these VWLSXODWLRQVLQRUGHUWRREWDLQ¿QDQFLQJRQWHUPVZKLFKDUHRWKHUwise acceptable.

Guidelines for remuneration of senior executives

Guidelines for the remuneration of the CEO and other senior executives were adopted by the 2016 Annual General Meeting. No deviations from these guidelines have been made. The Board of Directors of AAK proposes that the 2017 Annual General Meeting resolve that the same guidelines for remuneration of senior executives be applied in 2017 as in 2016. The present guidelines are contained in Note 8, Remuneration of the Board of Directors and Senior Executives.

These guidelines will cover those persons who are in Group management positions during the period of time in which the guidelines apply. The guidelines apply to agreements entered into after a resolution by the Annual General Meeting, and in the event that changes are made to existing agreements after this point in time. The Board will be entitled to diverge from the guidelines if there are particular reasons to do so in an individual case.

Product development

The Group's product development operations are described in further detail on pages 12–19.

Environment

The environmental impact from our plants includes emissions of odorous substances, solvents, smoke and gases into the atmosphere, as well as discharging fats, oxygen-consuming material, and nutrients into the water, and also creating organic waste and noise. We continually review our impact on all levels to further improve environmental performance at AAK. We operate all our

The proposed dividend is not expected to have a negative effect on the Company's and Group's ability to meet certain current liabili-WLHV7KH&RPSDQ\DQG*URXSKDYHVXI¿FLHQWDFFHVVWRERWKVKRUW term and long-term credits that can be obtained at short notice. The Board of Directors therefore considers that the Company and the Group are prepared for likely changes to liquidity, as well as unforeseen events. In addition, the Board of Directors has considered other known circumstances that may materially affect the ¿QDQFLDOSRVLWLRQRIWKH&RPSDQ\DQGWKH*URXS1RFLUFXPVWDQFH has arisen that makes the proposed dividend distribution appear XQMXVWL¿DEOH

It is proposed that the record date for the dividend be May 19, 2017, and it is estimated that the dividend will be received by the shareholders on May 24, 2017.

3URSRVHGDSSURSULDWLRQRISUR¿WV

7KH%RDUGRI'LUHFWRUVDQG&KLHI([HFXWLYH2I¿FHUSURSRVHWKDW

7KHGLVSRVDEOHSUR¿WEURXJKWIRUZDUG SEK 3,834,015,571
DQGSUR¿WORVVIRUWKH\HDU 6(.
Total SEK 3,814,884,025
be appropriated as follows:
To be distributed to shareholders,
a dividend of SEK 8.75 per share SEK 370,024,279 1)
To be carried forward SEK 3,444,859,746
Total SEK 3,814,884,025

1) Calculated on the number of outstanding shares as at the balance sheet date.

The Group's and the Parent's income statements and balance sheets will be presented to the annual general meeting on May 17, 2017 for adoption.

%DFNJURXQGWRDQGH[SODQDWLRQRIWKHSURSRVHGGLYLGHQG

The Board of Directors has proposed that the 2017 Annual *HQHUDO0HHWLQJDSSURYHDQDSSURSULDWLRQRISUR¿WVXQGHUZKLFK the shareholders will receive a dividend of SEK 8.75 per share. The proposed dividend therefore totals SEK 370 million. The REMHFWLYHLVIRUWKHGLYLGHQGLQWKHORQJWHUPWRFRUUHVSRQGWR± SHUFHQWRIFRQVROLGDWHGSUR¿WVDIWHUWD[ZKLOHDOZD\VFRQVLGHULQJ \$\$.¶VORQJWHUP¿QDQFLQJUHTXLUHPHQWV7KH3DUHQWKDVQR ¿QDQFLDOLQVWUXPHQWVYDOXHGXQGHU&KDS6HFWLRQDRIWKH Swedish Annual Accounts Act (1995:1554). The Board of Directors hereby makes the following statement regarding the proposed dividend, in accordance with Chap. 18, Section 4, of the Swedish Companies Act (2005:551).

5HWDLQHGSUR¿WVIURPWKHSUHYLRXV\HDUWRWDO6(.PLOOLRQ DQGWKHSUR¿WIRUWKH¿QDQFLDO\HDULV6(.PLOOLRQ6(. 1,040 million for the Group). Provided that the 2017 Annual General Meeting approves the Board's proposed appropriation RISUR¿WVDWRWDORI6(.PLOOLRQZLOOEHFDUULHGIRUZDUG7KH Company's restricted equity will be fully covered after distribution of the dividend.

,QWKH%RDUG¶VMXGJHPHQWWKH&RPSDQ\DQGWKH*URXSZLOO UHWDLQVXI¿FLHQWHTXLW\DIWHUGLVWULEXWLRQRIWKHSURSRVHGGLYLGHQG in relation to the nature, scope and risks associated with its business operations. In making this assessment, the Board has taken account of the historical development of the Company and the Group, budgeted performance and the economic situation.

In the view of the Board, the Company and the Group are in a position and have the capacity, in both the short and long terms, to meet all their obligations. The proposed dividend represents a total of 9 percent of the Company's equity and 5 percent of the Group's equity attributable to the Parent's shareholders.

After payment of the dividend, the equity/assets ratio of the Company and the Group will be 74 percent and 43 percent, respectively. These ratios are good in relation to other businesses LQRXULQGXVWU\7KH%RDUGRI'LUHFWRU¶VMXGJHVWKDWWKH&RPSDQ\ and the Group are in a good position to meet future business risk and withstand possible losses. Distribution of the dividend will not negatively affect the ability of the Company and the Group to make further investment as planned by the Board of Directors.

&RQVROLGDWHG,QFRPH6WDWHPHQW

Jan–Dec Jan–Dec
6(.PLOOLRQ 1RWH
1HWVDOHV
2WKHURSHUDWLQJLQFRPH
7RWDORSHUDWLQJLQFRPH
5DZPDWHULDOVDQGFRQVXPDEOHVDQGFKDQJHVLQLQYHQWRULHV
RI¿QLVKHGJRRGVDQGZRUNLQSURJUHVV
*RRGVIRUUHVDOH
2WKHUH[WHUQDOH[SHQVHV
(PSOR\HHEHQH¿WVH[SHQVHV
'HSUHFLDWLRQDPRUWL]DWLRQDQGLPSDLUPHQWORVV
2WKHURSHUDWLQJH[SHQVHV
7RWDORSHUDWLQJH[SHQVHV
2SHUDWLQJSUR¿W(%,7
5HVXOWIURP¿QDQFLDOLWHPV
)LQDQFLDOLQFRPH
)LQDQFLDOH[SHQVHV
1HW¿QDQFLDOLWHPV
3UR¿WEHIRUHWD[
,QFRPHWD[
3UR¿WIRUWKH\HDU
Attributable to:
1RQFRQWUROOLQJLQWHUHVWV
3DUHQWFRPSDQ\VKDUHKROGHUV
Earnings per share attributable to
Parent shareholders during the year
6(.SHUVKDUH?±EHIRUHGLOXWLRQ
6(.SHUVKDUH?±DIWHUGLOXWLRQ

&RQVROLGDWHG6WDWHPHQWRI&RPSUHKHQVLYH,QFRPH

6(.PLOOLRQ 1RWH
3UR¿WIRUWKHSHULRG
,WHPVWKDWZLOOQRWEHUHFODVVL¿HGWRSUR¿WRUORVV
5HPHDVXUHPHQWVRISRVWHPSOR\PHQWEHQH¿WREOLJDWLRQV


,WHPVWKDWPD\VXEVHTXHQWO\EHUHFODVVL¿HGWRSUR¿WRUORVV
7UDQVODWLRQGLIIHUHQFHV
6(.PLOOLRQ 1RWH Jan–Dec
Jan–Dec
3UR¿WIRUWKHSHULRG
,WHPVWKDWZLOOQRWEHUHFODVVL¿HGWRSUR¿WRUORVV
5HPHDVXUHPHQWVRISRVWHPSOR\PHQWEHQH¿WREOLJDWLRQV

,WHPVWKDWPD\VXEVHTXHQWO\EHUHFODVVL¿HGWRSUR¿WRUORVV
7UDQVODWLRQGLIIHUHQFHV
)DLUYDOXHFKDQJHVLQFDVKÀRZKHGJHV
7D[DWWULEXWDEOHWRIDLUYDOXHFKDQJHVLQFDVKÀRZKHGJHV
207 63
7RWDOFRPSUHKHQVLYHLQFRPHIRUWKHSHULRG
Attributable to:
1RQFRQWUROOLQJLQWHUHVWV
3DUHQWFRPSDQ\VKDUHKROGHUV

Consolidated Balance Sheet

6(.PLOOLRQ 1RWH 'HF 'HF
ASSETS
Non-current assets
Intangible assets 15
Goodwill 1,686 1,567
Patents and other intangible assets 357 377
2,043 1,944
Property, plant and equipment 16
Land and buildings 819 747
Plant and machinery 2,679 2,432
(TXLSPHQWWRROVDQG¿[WXUHVDQG¿WWLQJV
Assets under construction 1,474 942
Financial assets
Shares in associates 24 27
Deferred tax assets 12 201 97
Other non-current receivables 8 25
233 149
7RWDOQRQFXUUHQWDVVHWV
Current assets
Inventories 18 4,850 3,599
Accounts receivables 3 3,027 2,426
Current tax assets 12 219 239
Other receivables 171 170
Derivative instruments 3 715 464
Prepaid expenses and accrued income 176 151
Cash and cash equivalents 19 586 459
7RWDOFXUUHQWDVVHWV
727\$/\$66(76

Consolidated Balance Sheet (cont.)

6(.PLOOLRQ 1RWH 'HF 'HF
EQUITY AND LIABILITIES
Shareholders' equity 20
Share capital 423 423
Reserves 461 255
5HWDLQHGSUR¿W
(TXLW\DWWULEXWDEOHWR3DUHQW¶VVKDUHKROGHUV
Non-controlling interests 54 53
7RWDOHTXLW\
LIABILITIES
Non-current liabilities
Interest-bearing liabilities
Liabilities to banks and credit institutions 21 2,857 2,132
Pension provisions 9 134 128
2,991 2,260
Non-interest-bearing liabilities
Deferred tax liabilities 12 520 454
Other non-current provisions 22 70 62
Other non-current liabilities 250 226
7RWDOQRQFXUUHQWOLDELOLWLHV
Current liabilities
Interest-bearing liabilities
Liabilities to banks and credit institutions 21 217 287
Other current liabilities 1 2
Non-interest-bearing liabilities
Accounts payables 3 3,258 2,383
Current tax liabilities 12 357 311
Other current liabilities 200 135
Other current provisions 22 121 150
Derivative instruments 3 724 304
Accrued expenses and prepaid income 23 899 672
7RWDOFXUUHQWOLDELOLWLHV
727\$/(48,7<\$1'/,\$%,/,7,(6
Attributable to the Parent's shareholders Non-
6(.PLOOLRQ 6KDUHFDSLWDO 5HVHUYHV Retained
SUR¿W
controlling
LQWHUHVWV
Total
HTXLW\
Opening balance as at
-DQXDU\
3UR¿WIRUWKH\HDU
2WKHUFRPSUHKHQVLYHLQFRPH
&RPSUHKHQVLYHLQFRPH
Transactions with shareholders
1HZVKDUHLVVXH
'LYLGHQG
7RWDOWUDQVDFWLRQVZLWKVKDUHKROGHUV
Closing balance as at
'HFHPEHU
Attributable to the Parent's shareholders Non-
Retained controlling Total
6(.PLOOLRQ 6KDUHFDSLWDO 5HVHUYHV SUR¿W LQWHUHVWV HTXLW\
Opening balance as at
-DQXDU\
3UR¿WIRUWKH\HDU
2WKHUFRPSUHKHQVLYHLQFRPH
&RPSUHKHQVLYHLQFRPH
Transactions with shareholders
&KDQJHLQQRQFRQWUROOLQJLQWHUHVWV
'LYLGHQG
7RWDOWUDQVDFWLRQVZLWKVKDUHKROGHUV
Closing balance as at
'HFHPEHU

)RUIXUWKHULQIRUPDWLRQVHH1RWH

## &RQVROLGDWHG&KDQJHVLQ6KDUHKROGHUV¶(TXLW\

Consolidated Cash Flow Statement

Jan–Dec Jan–Dec
6(.PLOOLRQ 1RWH
OPERATING ACTIVITES
2SHUDWLQJSUR¿W
Depreciation and amortization 464 431
Other non-cash items 30 -37 -100
&DVKÀRZEHIRUHLQWHUHVWDQGWD[
Interest paid and received -163 -114
Tax paid -403 -270
&DVKÀRZEHIRUHFKDQJHVLQZRUNLQJFDSLWDO
Changes in inventory -818 -292
Changes in accounts receivables -489 126
Changes in accounts payables 814 148
Changes in other working capital items 230 398
&KDQJHVLQZRUNLQJFDSLWDO
&DVKÀRZIURPRSHUDWLQJDFWLYLWHV
INVESTING ACTIVITIES
Acquisition of intangible assets -11 -25
Acquisition of property, plant and equipment -966 -969
Acquisition of operations and shares, net of cash acquired 27 -449 -123
Proceeds from sale of property, plant and equipment 5 1
Divestment of operations and shares - 100
&DVKÀRZIURPLQYHVWLQJDFWLYLWHV
FINANCING ACTIVITIES
New share issue - 107
Loans raised 2,172 269
Amortization of loans -1,527 -613
Dividends paid -328 -284
&DVKÀRZIURP¿QDQFLQJDFWLYLWHV
&DVKÀRZIRUWKH\HDU
Cash and cash equivalents at beginning of year 459 264
Exchange rate difference for cash equivalents 18 -4
&DVKDQGFDVKHTXLYDOHQWVDW\HDUHQG

# ,QFRPH6WDWHPHQW±3DUHQW&RPSDQ\


-DQ±'HF -DQ±'HF
6(.PLOOLRQ 1RWH
1HWVDOHV
2WKHURSHUDWLQJLQFRPH
7RWDORSHUDWLQJLQFRPH
2WKHUH[WHUQDOH[SHQVHV
3HUVRQQHOFRVWV
'HSUHFLDWLRQDPRUWL]DWLRQDQGLPSDLUPHQWORVV
2WKHURSHUDWLQJH[SHQVHV
7RWDORSHUDWLQJH[SHQVHV
2SHUDWLQJSUR¿W(%,7
3UR¿WIURP¿QDQFLDOLWHPV
3UR¿WIURPLQWHUHVWVLQ*URXSFRPSDQLHV
,QWHUHVWH[SHQVHVDQGVLPLODULWHPV
1HW¿QDQFLDOLWHPV
3UR¿WEHIRUHWD[
,QFRPHWD[
3UR¿WIRUWKH\HDU

### 6WDWHPHQWRI&RPSUHKHQVLYH,QFRPH±3DUHQW&RPSDQ\



6(.PLOOLRQ

1RWH
-DQ±'HF
-DQ±'HF
3UR¿WIRUWKHSHULRG
2WKHUFRPSUHKHQVLYHLQFRPH
7RWDOFRPSUHKHQVLYHLQFRPHIRUWKHSHULRG

Balance Sheet – Parent Company

6(.PLOOLRQ 1RWH 'HF 'HF
ASSETS
Non-current assets
Intangible non-current assets 5

Property, plant and equipment 4
4
Financial non-current assets
Shares in Group companies 17 2,426 2,421
Receivables from Group companies 3,052 3,055
Other non-current liabilities 8

7RWDOQRQFXUUHQWDVVHWV



Current assets
Receivables from Group companies 135 180
Tax assets 12 6
Other receivables 1
Prepaid expenses and accrued income 2
Total current assets 144 193
727\$/\$66(76
EQUITY AND LIABILITIES
EQUITY 20
Restricted equity
Share capital 423 423
Statutory reserve 5

Non-restricted equity
5HWDLQHGSUR¿W
3UR¿WORVVIRUWKH\HDU

7RWDOHTXLW\
LIABILITIES
Non-current liabilities
Other non-current liabilities 8

Current liabilities
Interest-bearing liabilities
Liabilities to Group companies 1,301 1,007
Non-interest-bearing liabilities
Accounts payables 9
Liabilities to Group companies 20
Other current liabilities 19
Accrued expenses and prepaid income 23 39


7RWDOOLDELOLWLHV



727\$/(48,7<\$1'/,\$%,/,7,(6

# &KDQJHVLQ6KDUHKROGHUV¶(TXLW\ ±3DUHQW&RPSDQ\

6(.PLOOLRQ 6KDUHFDSLWDO 6WDWXWRU\UHVHUYH 5HWDLQHGSUR¿W 7RWDOHTXLW\
2SHQLQJEDODQFHDVDW-DQXDU\
3UR¿WIRUWKH\HDU
2WKHUFRPSUHKHQVLYHLQFRPH
1HZVKDUHLVVXH
7RWDOFRPSUHKHQVLYHLQFRPH
'LYLGHQG
&ORVLQJEDODQFHDVDW'HFHPEHU
2SHQLQJEDODQFHDVDW-DQXDU\
3UR¿WIRUWKH\HDU
2WKHUFRPSUHKHQVLYHLQFRPH
1HZVKDUHLVVXH
7RWDOFRPSUHKHQVLYHLQFRPH
'LYLGHQG
&ORVLQJEDODQFHDVDW'HFHPEHU

7RWDOVKDUHVRXWVWDQGLQJZHUHDWTXRWDYDOXHRI6(.SHUVKDUH)RUIXUWKHULQIRUPDWLRQVHH1RWH

Cash Flow Statement – Parent Company

Jan–Dec Jan–Dec
6(.PLOOLRQ 1RWH
OPERATING ACTIVITIES
3UR¿WDIWHU¿QDQFLDOLWHPV
Reversal of amortization and impairment losses 1 1
\$GMXVWPHQWIRULWHPVQRWLQFOXGHGLQFDVKÀRZ
Income tax paid -7 1
&DVKÀRZIURPRSHUDWLRQVEHIRUHFKDQJHVWRZRUNLQJFDSLWDO
Changes in working capital
Net change in other current receivables 48 -37
Net change in other current operating liabilities 11 12
&DVKÀRZIURPRSHUDWLQJDFWLYLWLHV
INVESTING ACTIVITIES
Acquisition of property, plant and equipment -5 -5
&DVKÀRZIURPLQYHVWLQJDFWLYLWLHV
FINANCING ACTIVITIES
New share issue - 107
Loans raised from Group companies 294 204
Dividend -328 -284
&DVKÀRZIURP¿QDQFLQJDFWLYLWLHV
&DVKÀRZIRUWKH\HDU
Cash and cash equivalents at beginning of year 0 0
Cash and cash equivalents at year-end 0 0

NOTE 1 – GENERAL INFORMATION

AAK AB (publ.), corporate identity number 556669-2850, is a Swedish registered limited liability company domiciled in Malmö, Sweden. The shares of the Parent are listed on NASDAQ OMX Stockholm, in the Large Cap list and under Consumer Commodities. The head office is located at Skrivaregatan 9, 215 32 Malmö, Sweden.

These consolidated financial statements for 2016 are for the Group consisting of the Parent and all subsidiaries. The Group DOVRKDVRZQHUVKLSLQWHUHVWVLQDVVRFLDWHVDQGMRLQWYHQWXUHV7KH%RDUGRI'LUHFWRUVDSSURYHGWKHVHFRQVROLGDWHGILQDQFLDO statements for publication on March 31, 2017.

NOTE 2 – SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

The principal accounting policies applied in the preparation of these consolidated financial accounts are set out below.

Basis of presentation of the annual report and consolidated financial statements

The Group's consolidated financial statements have been prepared in accordance with the International Financial Reporting Standards (IFRS) as adopted by the International Accounting Standard Board (IASB) and the interpretations issued by the International Financial Reporting Interpretations Committee (IFRIC) as adopted within the EU, the Swedish Annual Accounts Act, DQGWKH6ZHGLVK)LQDQFLDO5HSRUWLQJ%RDUG¶VUHFRPPHQGDWLRQ5)5µ6XSSOHPHQWDU\DFFRXQWLQJUXOHVIRUJURXSVRIFRPSDQLHV¶ The Parent company has prepared its financial statements in accordance with the Swedish Annual Accounts Act and the Swedish )LQDQFLDO5HSRUWLQJ%RDUG¶VUHFRPPHQGDWLRQ5)5µ\$FFRXQWLQJIRUOHJDOHQWLWLHV¶

The annual and consolidated financial statements have been prepared on a historical cost basis, with the exception of currency, fixed-income and commodity derivative instruments, which are measured at fair value through profit or loss. Preparing these financial statements requires that the Board of Directors and the Company management use certain critical accounting estimates and assumptions. These estimates and assumptions can materially affect the income statement, balance sheet and other information contained herein, including contingent liabilities; see Note 4. Actual outcome can vary from these estimates under different assumptions or circumstances.

New and changed standards applied by the Group

None of the new standards and changes in and interpretations of existing standards that have been published and are obligatory for the consolidated financial statements for financial years starting on January 1, 2016 or later have had any material impact on the consolidated financial statements.

New standards and interpretations that have not yet been applied by the Group

A number of new standards and interpretations enter into force for financial years that start after January 1, 2016 and were not applied when preparing these financial statements. None of these are expected to have any significant effect on the Group's financial statements, except those shown below:

,)56)LQDQFLDOLQVWUXPHQWV

IFRS 9 'Financial instruments' concerns the classification, valuation and reporting of financial assets and liabilities. The full version of IFRS 9 was published in July 2014. It replaces the parts of IAS 39 that concern the classification and valuation of financial instruments. IFRS 9 retains a mixed valuation approach, but simplifies this approach in certain respects. There will be three valuation categories for financial assets, amortized cost, fair value through other comprehensive income and fair value through the income statement. How an instrument should be classified depends on the company's business model and the characteristics of the instrument. Investments in own capital instruments must be recognized at fair value through the income statement, but it is also possible, when the instrument is first recognized, for it to be recognized at fair value through other comprehensive income. No reclassification to the income statement will then take place in connection with disposal of the instrument. IFRS 9 also introduces a new model for calculating credit loss reserves based on expected credit losses. For financial liabilities, the classification and valuation are not changed except where a liability is recognized at fair value through the income statement based on the fair value alternative. Changes in value attributable to changes in own credit risk must then be recognized in other comprehensive income. IFRS 9 reduces the requirements for application of hedge accounting by replacing the 80–125 criterion with requirements for an economic relationship between hedging instruments and hedged items and for the hedging quota to be the same as that used in risk management. Hedging documentation is also changed slightly compared with that prepared under IAS 39. The standard must be applied for the financial year beginning January 1, 2018. Earlier application is permitted. The Group has not yet evaluated the full effect of the introduction of the standard, but will carry out an analysis of this in 2017. A preliminary assessment is that the change in standard will not have a material impact on the Group's financial reports.

,)565HYHQXHIURPFRQWUDFWVZLWKFXVWRPHUV

,)56µ5HYHQXHIURPFRQWUDFWVZLWKFXVWRPHUV¶JRYHUQVKRZUHYHQXHVKRXOGEHUHFRJQL]HG7KHSULQFLSOHVRQZKLFK,)56 is based are designed to give users of financial statements more useful information about the company's revenue. The extended duty of disclosure means that information on revenue type, the time of settlement, uncertainties linked to recognition of revenue and cash flow attributable to the company's contracts with customers must be provided. According to IFRS 15, revenue must be recognized when the customer gains control over the product or service sold and is able to use the product or service and gain benefit from it.

Notes Amounts stated in SEK million unless specified otherwise.

IFRS 15 replaces IAS 18 Revenue and IAS 11 Construction Contracts and the associated SIC and IFRIC. IFRS 15 enters into force on January 1, 2018. The standard has not yet been adopted by the EU. Premature application is permitted. The Group has not yet evaluated the full effect of the introduction of the standard, but will carry out an analysis of this in 2017. A preliminary assessment is that the change in standard will not have a material impact on the Group's financial reports.

IFRS 16 Leases

In January 2016, IASB published a new leasing standard that will replace IAS 17 Leases and the associated interpretations IFRIC 4, SIC-15 and SIC-27. The standard requires that assets and liabilities attributable to all leases, with some exceptions, be recognized in the balance sheet. This recognition is based on the view that the lessee has a right to use an asset during a specific period of time and also has an obligation to pay for this right. The recognition for the lessor will be essentially unchanged. The standard is applicable for a financial year beginning January 1, 2019 or later. Premature application is permitted. The EU has not yet adopted the standard. The Group has not yet evaluated the effects of IFRS 16.

No other of the IFRS or IFRIC interpretations that have not yet entered into force are expected to have any significant impact on the Group.

&RQVROLGDWHGILQDQFLDOVWDWHPHQWV

Subsidiaries

The consolidated financial statements cover AAK AB and all its subsidiaries. Subsidiaries are all companies over which the Group has a controlling influence. The Group controls a company when it is exposed to or is entitled to variable return from its holding in the company and is able to affect the return by exerting influence in the company. Subsidiaries are included in the consolidated financial statements as from the date on which the controlling influence is transferred to the Group. They are excluded from the consolidated financial statements as from the date on which the controlling influence ceases.

Purchase method

The acquisition of subsidiaries is recognized using the purchase method of accounting. The cost of acquisition is measured as the fair value of the assets provided as consideration, liabilities incurred and shares issued by the Group. Transaction costs relating to acquisitions are expensed as they are incurred. Identifiable assets acquired and liabilities and obligations assumed in an acquisition are measured initially at fair value at the acquisition date. For each acquisition, the Group determines whether all non-controlling interests in the acquired companies are to be recognized at fair value or according to the proportional share of the acquired company's net assets. The excess of the purchase price, any non-controlling interests and the fair value of previous shareholdings at the acquisition date over the fair value of the Group's interest in identifiable net assets is recognized as goodwill. If this amount is less than the fair value for the acquired subsidiary's assets, the difference is recognized directly in the statement of comprehensive income.

All intra-group transactions, balances and unrealized gains on transactions are eliminated, unless the transaction provides evidence of impairment of the asset transferred. Accounting policies of subsidiaries have been changed where necessary to ensure consistency with the policies adopted by the Group.

7UDQVDFWLRQVZLWKKROGHUVRIQRQFRQWUROOLQJLQWHUHVWV

The Group handles transactions with holders of non-controlling interests in the same ways as transactions with the Group's shareholders. In the event of acquisitions from holders of non-controlling interests, the company recognizes the difference between the purchase price paid and the actual acquired portion of the carrying amount of the subsidiary's net assets in equity. Gains and losses on disposals to holders of non-controlling interests are also recognized in equity.

When the Group no longer holds a controlling or significant influence, each shareholding is remeasured at fair value and the change in the carrying amount is recognized in the income statement. Fair value is used as the primary carrying amount and IRUPVWKHEDVLVIRURQJRLQJUHFRJQLWLRQRIWKHUHPDLQLQJRZQHUVKLSLQWHUHVWDVDQDVVRFLDWHFRPSDQ\MRLQWYHQWXUHRUILQDQFLDO DVVHW\$OODPRXQWVUHODWLQJWRGLYHVWHGXQLWVSUHYLRXVO\UHFRJQL]HGXQGHU³2WKHUFRPSUHKHQVLYHLQFRPH´DUHUHFRJQL]HGDV though the Group had directly disposed of the respective assets or liabilities. This can result in amounts previously recognized in ³2WKHUFRPSUHKHQVLYHLQFRPH´EHLQJUHFODVVLILHGDVHDUQLQJV

If the equity interest in an associate is reduced but significant influence still remains, where relevant only a proportional share RIWKHDPRXQWVSUHYLRXVO\UHFRJQL]HGLQ³2WKHUFRPSUHKHQVLYHLQFRPH´LVUHFRJQL]HGDVHDUQLQJV

Associated companies

Associates are those companies where the Group has significant influence, but not a controlling influence over operational and financial management, usually through an ownership interest of between 20 percent and 50 percent of the voting rights. As of the date at which the significant influence is acquired, investments in associated companies are recognized in the consolidated financial statements using the equity method. The equity method means that the value of the shares in the associated companies recognized for the Group corresponds to the Group's interest in the equity of the associates plus Group-related goodwill and any residual values of Group-related surplus or shortfall in value. The consolidated income statement reports the Group's share of SURILWRIDVVRFLDWHGFRPSDQLHVDGMXVWHGIRUDQ\DPRUWL]DWLRQLPSDLUPHQWRUGLVVROXWLRQRIDFTXLUHGVXUSOXVRUVKRUWIDOOYDOXHVDV other financial revenue. Dividends received from associated companies reduce the carrying amount of the investment. The equity method is used until significant influence ceases.

Foreign currency translation of foreign subsidiaries' financial statements Functional and presentation currency

Items included in the financial statements of each of the Group's subsidiaries are measured using the currency of the primary economic environment in which they operate (functional currency). The consolidated financial statements are presented in Swedish krona which is the Parent's functional and presentation currency. Exchange rate differences that arise in translation of Group companies are recognized as a separate item in comprehensive income.

Transactions and balance sheet items

Foreign currency transactions are translated into the functional currency using the exchange rates prevailing on the dates of the transactions. Foreign exchange gains and losses resulting from the settlement of such transactions and from the translation of monetary assets and liabilities denominated in foreign currencies at the closing rate are recognized as of the end of the reporting period in the income statement.

*URXSFRPSDQLHV

The results and financial position of foreign subsidiaries (none of which has the currency of a hyperinflationary economy) that have a functional currency other than the presentation currency are translated into the Group's presentation currency as follows:

  • Assets and liabilities are translated at the closing day rate.
  • Income and expenses are translated at average exchange rates.
  • All exchange rate differences are charged directly to comprehensive income and are recognized as a separate item. When a foreign subsidiary is sold, any exchange differences are recognized in the income statement as part of the gain or loss on the sale.

*RRGZLOODQGIDLUYDOXHDGMXVWPHQWVDULVLQJLQWKHDFTXLVLWLRQRIIRUHLJQRSHUDWLRQVDUHWUHDWHGDVDVVHWVDQGOLDELOLWLHVRIWKHHQWLW\ and translated at the closing day rate.

([FKDQJHUDWHV

The following rates were used to translate currency:

Currency Average rate Closing rate
EUR 9.45 9.58
DKK 1.27 1.29
GBP 11.61 11.20
MXN 0.46 0.44
USD 8.59 9.08

6HJPHQWUHSRUWLQJ

An operating segment is the part of the Group that conducts business operations from which it may generate revenue and incur expenses for which discrete financial information is available. The operating results of an operating segment are followed up by the Group's chief operating decision-maker in order to evaluate its performance and allocate resources to the operating segment. The Group's operations are divided up into operating segments based on which parts of the operations the Group's chief operating decision-maker monitors, that is, according to the management approach. AAK's business operations are organized in such a way that the Group's highest executive decision-maker, that is the CEO, monitors earnings, returns and cash flows generated by the Group's various products. Each operating segment has a manager who is responsible for day-today operations and who regularly reports to the CEO on the outcome of the operating segment's performance and its resource requirements. Where the CEO monitors profit/loss and determines resource allocations based on the product that the Group produces and sells, these constitute the Group's operating segments.

The Group's operations are organically divided into business segments based on product. The marketing organization also reflects this structure. Segment reporting is submitted in accordance with IFRS 8 for the Group only. For each segment, the results, assets and liabilities directly attributable to or items that can reliably be attributed to the segment are included in that segment. Items not attributable in this way include interest and dividend revenues, gains and losses from the sale of financial investments, interest expenses, and tax expenses. Assets and liabilities not attributed to a segment include tax assets and tax liabilities, financial investments and financial liabilities.

5HYHQXHUHFRJQLWLRQ

Revenue comprises the fair value of goods sold excluding VAT and discounts after eliminating intra-group sales. Sales are recognized on delivery of the goods, after customer acceptance and after the receivable can reasonably be deemed safe. Interest income is recognized allocated over the maturity of the security using the effective interest method. Insurance compensation is recognized as revenue when the amount can be measured in a reliable way and it is probable that the revenue will flow to the Group.

(PSOR\HHEHQHILWV

a) Pension liabilities

A defined contribution plan is a pension plan under which the Group pays fixed contributions into a separate legal entity. The Group has no legal or constructive obligations to pay further contributions if this legal entity does not hold sufficient assets to pay all employee benefits relating to employee service in the current or prior periods. A defined benefit pension plan is a pension plan that is not a defined contribution plan.

The characteristic feature of a defined benefit plan is that it defines an amount of pension benefit that an employee will receive on retirement, usually dependent on one or more factors such as age, years of service and remuneration.

The liability recognized in the balance sheet in respect of defined benefit pension plans is the present value of the defined benefit obligation at the end of the reporting period less the fair value of plan assets. The defined benefit obligation is calculated DQQXDOO\E\LQGHSHQGHQWDFWXDULHVXVLQJWKHSURMHFWHGXQLWFUHGLWPHWKRG7KHSUHVHQWYDOXHRIWKHGHILQHGEHQHILWREOLJDWLRQLV determined by discounting the estimated future cash flows using interest rates of high-quality mortgage bonds that are denominated in the same currency in which the benefits will be paid, and that have terms of maturity approximating the terms in the related pension commitment.

Past-service costs are recognized immediately in the income statement.

The net interest rate is calculated by the discount rate being applied to defined benefit plans and to the fair value of plan assets. This expense is included in the personnel costs in the income statement.

\$FWXDULDOJDLQVDQGORVVHVDVDUHVXOWRIH[SHULHQFHEDVHGDGMXVWPHQWVDQGFKDQJHVLQDFWXDULDODVVXPSWLRQVDUHUHFRJQL]HG in other comprehensive income in the period in which they arise.

b) Termination benefits

Employees receive compensation on termination before normal retirement age or when they voluntarily accept termination in exchange for these benefits. The Group recognizes termination benefits when it is demonstrably committed to either terminating the employment of current employees according to a detailed, formal plan without possibility of withdrawal; or providing termination benefits as a result of an offer made to encourage voluntary redundancy.

c) Variable remuneration

Annual variable remuneration is based on meeting set targets determined on an annual basis. These targets are related to the performance of the Company. The Group recognizes costs as and when earnings occur.

/HDVLQJ

Leasing is classified as operating leasing when the risks and benefits of ownership are retained by the lessor. All leasing agreements within the Group are classified as operating leases. Operating lease payments are recognized in the income statement on a straight-line basis over the period of the lease.

3URGXFWGHYHORSPHQW

Product development work is an integral part of production relating to process improvement measures that is expensed on a continuous basis as a part of the product cost as it arises. Research and development expenses are those related to work whose purpose is primarily to optimize the attributes and function of oils and speciality fats, either for the finished product in which these oils and fats are ingredients or to improve the efficiency of the production process of the finished product.

,QWDQJLEOHDVVHWV

Goodwill

Goodwill represents the excess of the cost of an acquisition over the fair value of the Group's share of the net identifiable assets of the acquired subsidiary on the date of acquisition. Goodwill on acquisitions of subsidiaries is included in intangible assets. Goodwill recognized separately is allocated to cash-generating units for the purpose of annual impairment testing. Goodwill is allocated to the cash-generating units that are expected to benefit from the acquisition. Goodwill is recognized at cost less accumulated impairment losses. Gains and losses on the disposal of an entity include the remaining carrying amount of goodwill relating to the entity sold.

When acquiring operations where cost is less than the net value of the acquired assets, borrowings, and any contingent liabilities, the difference is recognized directly in the income statement.

Other intangible assets

Other intangible assets include such assets as capitalized expenditure on IT, patents and trademarks. These assets have a defined useful life and are carried at cost less accumulated amortization and impairment losses. The cost associated with maintaining an intangible asset is recognized as part of the carrying value or as a separate asset only when it is probable that the future economic benefit associated with the asset will flow to the Group and the cost of the asset can be reliably measured. Other expenditures are expensed as they arise. Other intangible assets are amortized using the straight-line method over their estimated useful lives, normally 5 to 10 years.

3URSHUW\SODQWDQGHTXLSPHQW

Land and buildings comprise mainly factory buildings and offices. All property, plant and equipment is carried at cost, less accumulated depreciation. Acquisition cost includes expenditure that is directly attributable to the acquisition of an asset. Subsequent costs are included in the asset's carrying amount or are recognized as a separate asset, as appropriate, only when it is probable that future economic benefits associated with the assets will flow to the Group and the cost of the asset can be measured reliably. All other repairs and maintenance are expensed in the financial period in which they arise.

Land is not depreciated. Depreciation of other property, plant and equipment is allocated on a straight-line basis over the estimated useful lives of the assets to reduce their cost to residual values. Depreciation periods of between 3 and 15 years are used for plant and machinery, equipment, tools, fixtures and fittings. Industrial buildings and research laboratories are depreciated over 20 and 25 years, respectively, and office buildings over 50 years. When an asset's carrying amount may not be recoverable, the asset is immediately impaired to its recoverable amount.

\$VVHWV¶UHVLGXDOYDOXHDQGXVHIXOOLIHDUHUHYLHZHGDWWKHHQGRIHYHU\UHSRUWLQJSHULRGDQGDGMXVWHGDVUHTXLUHG Gains and losses on disposals are determined by comparing proceeds with the carrying amount. These are included in the income statement.

,PSDLUPHQWRIQRQILQDQFLDODVVHWV

Assets with indefinite useful lives are tested for impairment annually rather than being amortized. All assets are assessed in terms of impairment whenever events or changes in circumstances indicate that an asset's carrying amount exceeds its recoverable amount. Impairment reflects the excess of an asset's carrying amount over its recoverable amount. The recoverable amount is either the asset's fair value less any selling costs or its value in use, whichever is greater. For the purposes of assessment, assets are grouped on the basis of the lowest level at which there are separate identifiable cash flows (cash-generating units). Assets, other than financial assets and goodwill, for which impairment loss was previously recognized, are tested at the end of every reporting period to ascertain whether any reversal should be made.

,QYHQWRULHV

Inventories are stated at cost or net selling price, whichever is lowest. Cost is calculated using the first-in-first-out principle (FIFO) or weighted average prices. The nature and area of use of the product determines the method used. The cost of finished goods and work in progress includes direct material costs, direct labour and other direct manufacturing costs and a reasonable allocation of indirect manufacturing expenses based on normal production capacity, excluding borrowing costs. Net selling price is the estimated sale price in the ordinary course of business, less costs of completion and applicable variable costs to sell.

)LQDQFLDOLQFRPHDQGH[SHQVHV

Financial income consists of interest income on funds invested (including, where applicable, financial assets available for sale), dividend income, gains on the sale of financial assets available for sale, and gains on hedging instruments recognized in profit or loss. Dividend income is recognized when the right to receive payment has been established. Results from the sale of financial instruments are recognized when the risks and benefits associated with ownership of the instruments have been transferred to the buyer and the Group no longer has control of the instrument. Financial expenses consist of interest expenses on loans, the effect of the resolution of present value calculations for provisions, impairment of financial assets and those losses on hedging instruments recognized in profit or loss. Borrowing expenses are recognized in profit or loss, except where they are directly attributable to the acquisition, construction or production of assets that take considerable time to complete for their intended use or sale, in which case they are included in the cost of those assets. No borrowing expenses have been capitalized during the past two years. Exchange gains and losses are recognized net.

)LQDQFLDOLQVWUXPHQWV

The Group classifies its financial assets in the following categories: financial assets measured at fair value in profit or loss and loan receivables and accounts receivables. The classification is dependent on the purpose for which the financial asset was acquired. Management establishes the classification of financial assets at initial recognition.

(a) Financial assets recognized at fair value through profit or loss

Financial assets recognized at fair value through profit or loss are financial assets held for trading. A financial asset is classified under this category if it is acquired for the primary purpose of being sold shortly thereafter. Derivatives are classified as being held for trading unless they are designated as hedges. Assets in this category are classified as current assets if they are expected to be settled within 12 months, otherwise they are classified as non-current assets.

(b) Loan receivables and accounts receivables

Loan receivables and accounts receivables are non-derivative financial assets with fixed or determinable payments that are not quoted in an active market. These are included in current assets, with the exception of items with a maturity of more than 12 months after the end of the reporting period, which are classified as non-current assets. The Group's loan receivables and accounts receivables consist of accounts receivables and other receivables, as well as cash and cash equivalents in the balance sheet.

A financial asset or financial liability is recognized in the balance sheet when the Company enters a contract for the instrument (i.e. on the relevant business day).

A financial liability is recognized when the counterparty has performed and a contractual duty to pay arises, even if no invoice is received.

A financial asset is derecognized when the rights to cash flow in the contract mature or the rights are transferred in a transaction that transfers essentially all risks and remunerations from ownership to the assets transferred. This also applies to parts of financial assets.

A financial liability is removed from the balance sheet when the duty in the contract is performed or otherwise extinguished. This also applies to parts of financial liabilities. Loans and receivables are non-derivative financial assets with fixed or determinable payments that are not quoted on an active market. They arise when the Group provides money, goods or services directly to a debtor (usually a customer) with no intention of trading the receivable. These are recorded as current assets when WKHPDWXULW\LVOHVVWKDQPRQWKVIURPWKHWUDQVDFWLRQGDWH/RDQVDQGUHFHLYDEOHVDUHUHFRJQL]HGLQ³\$FFRXQWVUHFHLYDEOHV´ DQG³2WKHUUHFHLYDEOHV´LQWKHEDODQFHVKHHW

Loan receivables and accounts receivables are recognized after the acquisition date at amortized cost using the effective interest rate method. Financial instruments are initially recognized at fair value plus transaction costs, which applies to all financial assets that are not recognized at fair value through profit or loss, for which attributable transaction costs are instead recognized in the income statement.

'HULYDWLYHV

Derivative instruments are recognized in the balance sheet on the date of contract and at fair value, both initially and upon subsequent revaluation. The method of recognizing gain or loss arising from revaluation depends on whether the derivative is identified as a hedging instrument, and, in such event, the nature of the item being hedged. The Group identifies certain derivatives as either:

(a) hedging of fair value regarding a recognized asset or liability or a firm commitment (fair-value hedging),

(b) hedging of a particular risk associated with a recognized asset or liability or a highly probable forecast transaction (cash flow hedging).

When the transaction is undertaken, the Group documents the relationship between the hedging instrument and the hedged item, DVZHOODVWKHKHGJH¶VUROHLQWKH*URXS¶VULVNPDQDJHPHQWREMHFWLYHVDQGVWUDWHJ\7KH*URXSDOVRGRFXPHQWVLWVDVVHVVPHQW both when it enters into hedging contracts and on an ongoing basis, as to whether the derivative instruments used in hedging transactions are effective in terms of counteracting changes in fair value or cash flow that are attributable to the hedged items.

7KH&RPSDQ\¶VGHULYDWLYHLQVWUXPHQWVFRQVLVWRI27&RU³RYHUWKHFRXQWHU´GHULYDWLYHVFRQFOXGHGZLWKILQDQFLDOFRXQWHUSDUWLHV listed standardized derivatives and sales and purchase contracts that do not meet the exemption criteria for being recognized as a derivative (that is, that are not deemed to be for own use). According to IAS 39, only contracts not designed for physical delivery may be measured at market price. AAK's business model permits (enables) the net settlement of purchase and sales contracts entered into for physical delivery. Derivatives that are not used as hedging instruments for which hedge accounting is applied are recognized at fair value in the income statement.

+HGJHDFFRXQWLQJ

Hedging of fair value

Changes in fair value of a derivative that has been formally identified for hedging of fair value and meets the conditions for hedge accounting are recognized on the same line in the income statement as any change in fair value attributable to the hedged risk for the hedged asset or liability. The Group applies hedging of fair value for raw materials and foreign currency in sales and purchase contracts. The gain or loss attributable to the ineffective portion is recognized with immediate effect in SURILWRUORVVLQ´5DZPDWHULDOVDQGFRQVXPDEOHVDQGFKDQJHVLQLQYHQWRU\´

Cash flow hedges

The effective portion of changes in fair value in a derivative instrument, identified as a cash flow hedge and that fulfils the conditions for hedge accounting, is recognized in other comprehensive income. The gain or loss attributable to the ineffective SDUWLVUHFRJQL]HGZLWKLPPHGLDWHHIIHFWLQWKHLQFRPHVWDWHPHQWLWHP³2WKHUILQDQFLDOLWHPV´

Amounts in equity are reversed to the income statement. for those periods during which the hedged item affects profit or loss (e.g. when the forecast sale that is hedged takes place). The gain or loss that is attributable to the effective portion of an interest UDWHVZDSWKDWKHGJHVYDULDEOHUDWHERUURZLQJLVUHFRJQL]HGLQWKHLQFRPHVWDWHPHQWLWHP³)LQDQFLDOH[SHQVHV´7KHJDLQRUORVV DWWULEXWDEOHWRWKHLQHIIHFWLYHSRUWLRQLVUHFRJQL]HGLQWKHLQFRPHVWDWHPHQWLWHP³2WKHUILQDQFLDOLWHPV´,IDKHGJHRIDIRUHFDVW transaction subsequently leads to the recognition of a non-financial asset (e.g. inventory or property, plant and equipment), the

gains and losses previously recognized in equity are transferred from equity and included in the initial cost of the asset. Such WUDQVIHUUHGDPRXQWVZLOOODWHUEHUHFRJQL]HGLQ³&RVWRIJRRGVVROG´ZKHUHWKH\UHODWHWRLQYHQWRU\RULQ³'HSUHFLDWLRQ´ZKHUHWKH\ relate to non-current assets.

When a hedging instrument matures or is sold, or when the hedge no longer qualifies for hedge accounting and accumulated gains or losses relating to the hedge are booked in equity, these gains/losses remain in equity and are recognized in profit or loss when the forecast transaction is ultimately recognized in the income statement. When a forecast transaction is no longer expected to take place, the accumulated profit or loss recognized in equity is immediately transferred to the "Other operating LQFRPH´LWHPLQWKHLQFRPHVWDWHPHQW

Determining fair value

The fair value of instruments that do not have listed prices is determined using valuation techniques such as discounted cash flow models, in which all assessed and determined cash flows are discounted using a zero coupon yield curve. The fair value of derivatives is determined using valuation techniques. The valuation is based on models that discount cash flows using forward curves for underlying variables such as raw materials and exchange rates. The assessed and determined cash flows are discounted by a zero coupon interest rate curve. The Group's credit risk is taken into consideration in the valuation

at fair value.

Accounts receivables

Accounts receivables are recognized initially at fair value and thereafter at amortized cost using the effective interest method, OHVVSURYLVLRQVIRULPSDLUPHQW3URYLVLRQIRULPSDLUPHQWRIDFFRXQWVUHFHLYDEOHVLVUHFRJQL]HGZKHQWKHUHLVREMHFWLYHHYLGHQFH that the Group will not receive all the cash flow due according to the original amounts of the receivables. Provisions are measured as the difference between the assets' carrying amount and the present value of future cash flows discounted at the financial DVVHW¶VRULJLQDOHIIHFWLYHLQWHUHVWUDWH6XFKSURYLVLRQVDUHUHFRJQL]HGLQWKHLQFRPHVWDWHPHQWDV³2WKHUH[WHUQDOH[SHQVHV´

Share capital

Ordinary shares are classified as share capital. Transaction expenses that are directly attributable to new share issues or options are recognized, net of tax, in equity as a deduction from the proceeds.

Liabilities to banks and credit institutions

Borrowings are initially recognized at fair value, net of transaction costs. Borrowings are subsequently stated at amortized cost and any difference between proceeds (net of transaction costs) and redemption value is recognized in the income statement, allocated over the period of the borrowing using the effective interest method.

Accounts payables

Accounts payables are initially recognized at fair value and subsequently at amortized cost using the effective interest method.

Provisions

Provisions are recognized in the balance sheet when the Group has a present legal or constructive obligation as a result of past events, and it is more likely than not that an outflow of resources will be required to settle the obligations and the amount can be estimated reliably. No provisions are made for future operating losses. If the effect of when in time payment is made is significant, provisions are calculated through discounting the expected future cash flow at an interest rate before tax that reflects current market assessments of the time value of money and, if applicable, the risks associated with the debt.

A provision for restructuring is recognized when the Group has adopted a comprehensive and formal restructuring plan, and the restructuring has either been started or published.

Income tax

Tax expenses for the period comprise both current tax due and deferred income tax. Tax is recognized in the income statement, apart from when tax is attributable to items recognized in other comprehensive income or directly in equity. In such cases, tax is also recognized in other comprehensive income. Income tax is determined using the tax rules that have been enacted or announced by the balance sheet date and are expected to apply when the related deferred tax asset is realized or the deferred tax liability is settled. Tax expenses stated include both current tax due and deferred income tax.

Deferred tax is provided in full, using the liability method, on all temporary differences arising between the tax bases of assets and liabilities and their carrying amounts in the balance sheet. The principal temporary differences arise from depreciation of property, plant and equipment, provisions for pensions and other post-retirement benefits and tax losses carried forward. The tax rates enacted in each country are used in determining deferred income tax.

Deferred income tax assets for tax-deductible temporary differences and loss carry-forwards are recognized only to the extent it is likely that it will be possible to utilize these items. The value of deferred tax assets is derecognized when it is no longer deemed likely that they can be utilized.

Deferred income tax assets are recognized on temporary differences arising from investments in subsidiaries, except where the timing of the reversal of the temporary differences is controlled by the Group and it is probable that the difference will not be reversed in the foreseeable future.

Cash and cash equivalents

Cash equivalents comprise balances with less than three months' maturity, including cash, bank deposits and other current securities.

Cash flow statement

Payments in and out have been divided up into three categories: operating activities, investing activities and financing activities. The indirect method is used for flows from operating activities.

7KHFKDQJHVGXULQJWKH\HDULQRSHUDWLQJDVVHWVDQGRSHUDWLQJOLDELOLWLHVKDYHEHHQDGMXVWHGIRUWKHHIIHFWVRIFKDQJHVLQ exchange rates. Acquisitions and disposals are recognized under investing activities. The assets and liabilities that acquired and divested companies had at the time of the change are not included in the analysis of the changes in operating capital, nor in changes to balance sheet items recognized under investing and financing activities.

Earnings per share

The calculation of earnings per share is based on the consolidated profit attributable to the Parent's shareholders and the weighted average number of shares outstanding during the year.

When determining earnings per share after dilution, a company must base its calculations on the company's shares and stock options which could result in dilution being exercised. Compensation from these instruments will be deemed to have been received from the issuing of ordinary shares at the average market price for ordinary shares during the period. The difference between the number of issued ordinary shares and the number of ordinary shares that should have been issued at the average market price for ordinary shares during the period shall be treated as an issue of ordinary shares without consideration. According to paragraph 47 of IAS 33, options and stock options only have a dilutive effect when the average market price for ordinary shares during the period exceeds the exercise price for options or stock options.

Transfer pricing

Pricing between Group companies is carried out on market terms.

Dividend

The dividend to shareholders in the Parent is recognized as a liability in the consolidated financial statements in the period when the dividend was approved by the shareholders.

Accounting policies – Parent

The Parent company has prepared its financial statements in accordance with the Swedish Annual Accounts Act and the Swedish )LQDQFLDO5HSRUWLQJ%RDUG¶VUHFRPPHQGDWLRQ5)5µ\$FFRXQWLQJIRUOHJDOHQWLWLHV¶1RGLIIHUHQFHVZLWKWKH*URXS¶VDFFRXQWLQJ policies have been identified.

127(±),1\$1&,\$/5,6.0\$1\$*(0(17\$1'+('*(\$&&2817,1*

)LQDQFLDOULVNPDQDJHPHQW

The AAK Group's operations are exposed to various financial risks, including market price risks (on raw materials, currencies and interest rates), liquidity risk and credit risk. Since our products are sold throughout the world, our sales revenues are exposed to market fluctuations in the exchange rates of the currencies involved. Moreover, the Group buys its raw materials on international markets, so its cost of raw materials is exposed to market fluctuations in both the price of the raw materials and the exchange rates of the currencies involved.

Exposure to such significant financial risks makes managing these risks a significant factor in successful operations. We believe that we are largely successful in managing risks owing to the policies and procedures established for the Group.

The Group's management of price risk and other risks related to purchasing of raw materials is regulated by AAK's policy and principles on the management of market risk for raw materials, while currency risks and other financial risks are regulated by AAK's financial policy and principles. Policies and principles are established by AAK's Board of Directors, which also monitors, evaluates and updates these policies and principles annually.

5DZPDWHULDOSULFHULVNV

The Group's annual costs for raw materials are two-thirds of the sales value of the finished products. AAK hedges both operational raw material price risk and the underlying operational currency risk when sales agreements are signed with customers.

Raw material prices fluctuate, so the Group has assigned a high priority to raw material procurement and to managing this exposure. Raw material procurement is managed by the Group procurement organization, which continually monitors and controls raw material market exposure for the Group. However, to maintain an effective organization, the Group's procurement organization is permitted to take limited price risks within the framework of our trading policy established by the Board of Directors. Since these raw material positions are managed appropriately, AAK's profitability is affected only marginally by price changes. The effect on total sales and requirements for working capital is, however, significantly larger.

Hedge contracts are used to hedge raw material price risk. We hedge inventory and sales contracts using standard commodity futures traded on commodity exchanges, or using OTC hedge contracts or physical purchase contracts.

Exotic raw materials (of which shea is by far the most important) must be sourced when they are available right after the harvest season. No efficient hedge market exists for exotic raw materials. Therefore the Group is typically left with a significant unhedged volume of exotic raw materials in the months following the harvest season. The Group endeavours to limit this exposure by entering into new exotic-raw-material-based sales contracts during the months in which the exotic raw materials are sourced. AAK uses fair-value hedge accounting on stocks of oils and fats.

([SRVXUHWRUDZPDWHULDOSULFHULVN'HFHPEHU

7KRXVDQGWRQV ,QYHQWRU\ 6DOHVFRQWUDFWV 3XUFKDVHFRQWUDFWV 1HWH[SRVXUH
Oils and fats 209 -1,250 1,047 6
([SRVXUHWRUDZPDWHULDOSULFHULVN'HFHPEHU
7KRXVDQGWRQV ,QYHQWRU\ 6DOHVFRQWUDFWV 3XUFKDVHFRQWUDFWV 1HWH[SRVXUH
Oils and fats 212 -873 666 5

Sensitivity analysis – raw materials (excluding exotic raw materials)

With the stocks and commercial contracts hedged by raw material hedge contracts, leaving a very limited net exposure, changes in raw material prices have no significant effect on the Group's profit margin. A 10 percent change in all raw material prices would therefore have a negligible effect on Group operating profit, even though the annual effect on net sales is ± SEK 1,640 million (1,500) and ± SEK 400 million (300) on working capital.

Gross contribution for rapeseed

As explained above, our policies and procedures for risk management in general imply that our profit margin is not affected by changes in raw material prices. However, AAK cannot eliminate its exposure to market price fluctuations in relation to rapeseed crushing. The crushing margin (oil plus meal value less seed price) can vary over time and can thereby directly affect profitability within the Technical Products & Feed business area.

Exposure to foreign currency

A significant portion of the Group's buying and selling of raw materials is denominated in foreign currency. Moreover, most of the Group's operational subsidiaries are located outside Sweden. Changes in exchange rates therefore affect AAK in several ways:

  • Sales contracts and raw material contracts in foreign currency give rise to transaction risk.
  • Profits for our foreign subsidiaries are affected by changes in currency rates, when they are translated to SEK.
  • The Group's equity is affected when equity in our foreign subsidiaries is translated to SEK.

AAK hedges all its currency transaction risks. Payment for all sales contracts is thus hedged in the local currency of the subsidiaries that have entered into such sales contracts. Exchange rate risk related to translating equity and profit/loss in our foreign subsidiaries to SEK is not hedged.

Exposure to transaction risk, December 31, 2016

SEK million Sales
Purchase
Currency contracts
Assets Liabilities contracts contracts Sold Bought Net
exposure
USD 2,491 -4,274 1,012 -1,255 -1,586 3,600 -12
EUR 1,601 -1,048 876 -41 -1,887 509 10
GBP 74 -615 43 0 -445 949 6
Other 1,057 -237 333 -178 -5,979 5,051 47
Total -6,174 2,264 -1,474 10,109

([SRVXUHWRWUDQVDFWLRQULVN'HFHPEHU

SEK million
Assets
Sales Purchase Currency contracts Net
Liabilities
contracts
contracts Sold Bought exposure
USD 1,770 -2,726 785 -235 -1,765 2,143 -28
EUR 1,087 -985 1,236 -150 -1,515 366 38
GBP 7 -507 4 0 -57 553 0
Other 819 -326 355 -19 -3,559 2,752 22
Total 32

Sensitivity analysis – Currency

With all foreign currency transaction risk hedged by currency hedge contracts, leaving a very limited net exposure, changes in foreign currencies will have an insignificant effect on each subsidiary's profit margin. However, changes in foreign currencies relative to SEK do affect Group profit when the profit of each foreign subsidiary is translated into SEK. A 10 percent change in the exchange rates of all foreign currencies relative to SEK would have an effect of ± SEK 130 million (150) on Group operating profit. Furthermore, a 10 percent change in the exchange rates of all foreign currencies relative to SEK would affect Group net sales by SEK 1,600 million (1,400) and Group net working capital by SEK 300 million (300).

Interest rate risk

AAK's policy on interest rate risk management is to minimize volatility in cash flow and net profit caused by fluctuations in interest rates. However, during abnormal market conditions – e.g. a financial crisis – short-term interest rates can rise to extreme levels. In order to protect the Group's interest costs against such abnormal scenarios, the interest rate on part of the Group's net interestbearing debt can be fixed or capped.

At year-end 2016, the Group's interest-bearing net debt, including pensions, amounted to SEK 2,620 million (2,083). Since October 1, 2011, AAK has applied cash flow hedging with interest rate swaps as a general principle.

Effective interest rate on debt to banks and credit institutions at balance sheet date

SEK DKK USD CNY TRY BRL INR
2016 0.80 0.70 1.50 4.45 11.00 13.50 6.50
1.66 0.59 1.01 5.55 13.75 14.00 8.00

Sensitivity analysis – Interest rates

At the closing date, the Group had a floating-rate-based net debt of SEK 2,480 million (960). A 1 percent change in interest rates would therefore have a full-year effect of SEK 25 million (10) on the Group's interest costs before tax.

Loans and capital structure

AAK's policy on capital structure is to maximize debt financing, though not to a level that would threaten the Company's position as an investment grade company.

AAK's target key ratios are as follows: Target 2016
Net interest-bearing debt/EBITDA < 3.0 1.26 1.13

This target level is considered to be relatively conservative and contributes to ensuring that AAK will be able to retain its high credit rating.

The Group's policy is to allocate total net borrowings per subsidiary relative to each subsidiary's share of the Group's free cash flow. This minimizes the currency risk in relation to the Group's ability to pay interest on and amortize its borrowings, which in turn strengthens the Group's debt capacity.

Total borrowing reported in the balance sheet, per currency at balance sheet date

SEK million 2016
SEK 202 954
DKK 491 468
USD 1,433 441
CNY 81 73
TRY 240 195
BRL 296 66
INR 177 193
Other 154 29
Total 3,074 2,419

Liquidity risk

Liquidity risk concerns the Group's ability to meet its financial commitments as they fall due.

The table below shows all of the Group's financial commitments, listed by the earliest contractual maturity date at the balance sheet date. All liabilities to banks and credit institutions are based on variable interest rates, which means the year-end carrying value reflects the present value of these liabilities. All liabilities in foreign currency are translated into SEK at year-end closing rates.

Disclosure of financial liabilities by maturity date, December 31, 2016

Total Less than Between
1 and 2
Between More than
amount 1 year years DQG
years
\HDUV
Non-current liabilities
Financial liabilities
Liabilities to banks and credit institutions 2,857 478 - 1,888 491
Other non-current liabilities 250 - - - 250
Total non-current liabilities 3,107 - 741
Interest on liabilities to banks and credit institutions 483 16 - 416 51
Total non-current liabilities and interest 494 - 2,304 792
Current liabilities
Financial liabilities
Liabilities to banks and credit institutions 217 217 - - -
Accounts payables 3,258 3,258 - - -
Derivative financial instruments 724 724 - - -
Accrued expenses 899 899 - - -
Other current liabilities 200 200 - - -
Total current liabilities - - -
Interest on liabilities to banks and credit institutions 1 1 - - -
Total current liabilities and interest - - -

Unused credit facilities available to the Group at the 2016 year-end

Less than Between Between More than
Total amount 1 year 1 and 2 years DQG\HDUV \HDUV
Unused credit facilities 3,665 277 - 3,388 -

'LVFORVXUHRIILQDQFLDOOLDELOLWLHVE\PDWXULW\GDWH'HFHPEHU

7RWDO
DPRXQW
/HVVWKDQ
\HDU
%HWZHHQ
DQG
\HDUV
%HWZHHQ
DQG
\HDUV
0RUHWKDQ
\HDUV
1RQFXUUHQWOLDELOLWLHV
Financial liabilities
Liabilities to banks and credit institutions 2,132 375 - 1,432 325
Other non-current liabilities 226 - - - 226
7RWDOQRQFXUUHQWOLDELOLWLHV
Interest on liabilities to banks and credit institutions 495 11 - 299 185
7RWDOQRQFXUUHQWOLDELOLWLHVDQGLQWHUHVW
&XUUHQWOLDELOLWLHV
Financial liabilities
Liabilities to banks and credit institutions 287 287 - - -
Accounts payables 2,383 2,383 - - -
Derivative financial instruments 304 304 - - -
Accrued expenses 672 672 - - -
Other current liabilities 135 135 - - -
7RWDOFXUUHQWOLDELOLWLHV
Interest on liabilities to banks and credit institutions 1 1 - - -
7RWDOFXUUHQWOLDELOLWLHVDQGLQWHUHVW

8QXVHGFUHGLWIDFLOLWLHVDYDLODEOHWRWKH*URXSDWWKH\HDUHQG

/HVVWKDQ %HWZHHQ %HWZHHQ 0RUHWKDQ
7RWDODPRXQW \HDU DQG\HDUV DQG\HDUV \HDUV
Unused credit facilities 3,766 375 - 3,391 -

The Group's cash and cash equivalents of SEK 586 million, available credit facilities of SEK 3,665 million and future cash generated by the business are together deemed sufficient for the Group to meet its financial commitments.

&UHGLWULVN

The Company is exposed to credit risk primarily in relation to accounts receivables and customer contracts. Risk in the latter case is represented by customers' failure to meet their commitments due to changes in market prices. Generally, AAK's credit risks are significantly limited due to the stable, long-term business relationships we have with our customers and suppliers.

The customer structure for the Group is such that its single-largest customer is responsible for less than 5 percent of its total sales, and the average customer corresponds to less than 1 percent.

Nearly a quarter of the Group's sales occur in countries where the political and commercial risks are deemed to be higher than in Western economies. However, we experience only a limited need for impairments even in these countries. This is largely due to the fact that a significant portion of our business in these countries is with large multinational companies that also do business worldwide. The partners with whom we do business are also primarily companies with which we have stable, long-term relationships.

Each business segment is responsible for managing its customer credit risks, while our large production facilities are responsible for managing their counterparty risk in relation to raw material procurement.

3URYLVLRQVIRUGRXEWIXODFFRXQWVUHFHLYDEOHV

25 23
9 2
-2 0
0 0

Provisions for impairments are entirely related to accounts receivables. Total accounts receivables excluding provisions were SEK 3,059 million (2,401).

3DVWGXHDVVHWVQRWFRQVLGHUHGLPSDLUHG

6(.PLOOLRQ
1–30 days 398 334
31–120 days 68 52
121–360 days 17 1
Over 360 days 0 0

'HULYDWLYHVFODVVLILHGDVILQDQFLDOLQVWUXPHQWV

The Group had two classes of financial instruments (hedging instruments): raw material hedge contracts and currency hedge contracts. In December 2016 the Group only had derivative financial instruments that were measured at fair value. The fair value of the derivative financial instruments is measured using valuation methods and observable market data (methodology: level 2). The valuation methods applied are described in the accounting policy.

The Group's financial assets and liabilities measured at fair value

As at December 31, 2016 Assets and liabilities
measured at fair
value through the
income statement
Derivatives held for
hedging purposes
Derivatives
measured at fair
value through equity
SEK million Carrying
amount
Valuation
level
Carrying
amount
Valuation
level
Carrying
amount
Valuation
level
Total
Sales and purchase contracts 246 2 246
Currency hedge contracts 223 2 223
Fair value of changes in inventories 246 2 246
Total assets - -
Sales and purchase contracts 525 2 525
Currency hedge contracts 198 2 198
Fair value of changes in inventories 1 2 1
Total liabilities - 724 - 724

The Group's financial assets and liabilities measured at fair value

\$VDW'HFHPEHU Assets and liabilities
measured at fair
value through the
income statement
Derivatives held for
hedging purposes
Derivatives
measured at fair
value through equity
SEK million Carrying
amount
Valuation
level
Carrying
amount
Valuation
level
Carrying
amount
Valuation
level
Total
Sales and purchase contracts 256 2 256
Currency hedge contracts 103 2 103
Interest rate hedge swaps - 3 2 3
Fair value of changes in inventories 102 2 102
Total assets - 461 3 464
Sales and purchase contracts 188 2 188
Currency hedge contracts 90 2 90
Interest rate hedge swaps - 40 2 40
Fair value of changes in inventories -14 2 -14
Total liabilities - 264 40 304

Foreign currency contracts and the foreign currency components in sales and purchase contracts are valued at actual market foreign currency forward rates. The raw material price components in sales and purchase contracts are valued at actual market forward prices for identical or similar raw materials. Inventory is valued at actual market spot prices for identical or similar raw materials. Interest rate swap contracts are valued at actual market interest rates.

+HGJHDFFRXQWLQJ

,QYHQWRU\KHGJLQJDWIDLUYDOXH

Future contracts, and purchase and sales contracts not deemed to be assets for own use are used for hedging, which means that they cannot be exempted from derivative accounting. Since the quality of the underlying raw materials used for hedging differs from the quality of the hedged raw materials, some inefficiency is likely. AAK minimizes this inefficiency by reducing the basis risk between hedged raw material risks and the underlying raw materials used as hedging contracts. Due to the basis risk involved, \$\$.XVHVWKH³GROODURIIVHW´PHWKRGIRUWHVWLQJWKHKHGJHHIILFLHQF\RIWKHIDLUYDOXHRIUDZPDWHULDOV+HGJHHIILFLHQF\WHVWLQJLQ 2016 confirmed that the fair-value hedge of raw materials qualifies for hedge accounting. Hedge efficiency for the 2016 full year was 100 percent (106).

)DLUYDOXHKHGJHRIFXUUHQF\ULVNRQVDOHVFRQWUDFWVTXDOLI\LQJIRUH[HPSWLRQXQGHUDVVHWVIRURZQXVH

The hedging instruments used are future contracts and purchase contracts. As the currency risk of the hedge instruments is LGHQWLFDOWRWKHFXUUHQF\ULVNRIWKHKHGJHGFRQWUDFWVQRPDWHULDOEDVLFULVNH[LVWV\$\$.WKHUHIRUHRQO\XVHVWKH³FULWLFDOPDWFK´ method to test the hedge efficiency of currency risk on sales contracts that qualify for own use exemption and that may consequently be exempted from derivative accounting. The hedge efficiency testing in 2016 confirmed a perfect critical match.

NOTE 4 – CRITICAL ACCOUNTING ESTIMATES AND ASSUMPTIONS IN APPLYING ACCOUNTING

In preparing these financial statements, the Group management and Board of Directors must make estimates and assumptions that affect the recognized amounts of assets and liabilities, revenues and expenses, and other information, especially regarding contingent liabilities. The estimates and assumptions for accounting purposes dealt with in this section are deemed the most FULWLFDOIRUDSURSHUXQGHUVWDQGLQJRIWKHILQDQFLDOVWDWHPHQWVLQYLHZRIWKHLUGHJUHHRIVLJQLILFDQFHLQMXGJHPHQWVDQGXQFHUtainty. Our estimates and assumptions in this regard change as the circumstances for AAK's operations change.

Impairment testing of goodwill

7KH*URXSWHVWVJRRGZLOOIRUDQ\LPSDLUPHQWRQDQDQQXDOEDVLVRUZKHQHYHUHYHQWVRUREMHFWLYHFLUFXPVWDQFHVLQGLFDWHWKDW the fair value of acquisition-related goodwill may have declined – for example, because of changes in the business climate or decisions to dispose of or discontinue certain operations. To determine whether the value of goodwill has decreased, the cash-generating unit to which the goodwill is attributable must be valued and this is done by discounting the cash flow of the unit. In applying this method, the Company relies on several factors, such as profit/loss, business plans, financial forecasts and market data (see also Note 15).

Impairment test of other non-current assets

AAK's property, plant and equipment and intangible non-current assets, excluding goodwill, are recognized at cost less accumulated amortization/depreciation and any impairment. Besides goodwill, AAK recognizes no intangible assets with unlimited useful life. Depreciation/amortization is applied over the estimated useful life to an estimated residual value. Both the useful life and residual value are reviewed at least once at the end of each financial period.

The carrying amount of the Group's non-current assets is tested whenever events or changes in circumstances indicate that the carrying amount cannot be recovered. The carrying amount of intangible assets not yet finished for use is tested each year. If such an analysis indicates that the carrying amount is too high, the recovery value of the asset is established, which is either the net sales value or the value in use, whichever is greatest. Value in use is measured as the expected future discounted cash flow from the assets or the cash-generating unit to which the asset belongs.

Income tax

The Group is liable to pay taxes in many countries. Extensive reviews and testing are necessary to establish worldwide provisions for income tax liabilities. There are many transactions and calculations for which the final tax is uncertain. The Group recognizes a liability for anticipated tax audit issues based on assessment of whether an additional tax liability will arise. In cases where the final tax for these matters differs from the amounts first recognized, these differences will impact current and deferred tax assets and tax liabilities in the period when these determinations are made.

Disputes

According to our best assessment, neither the Parent nor any subsidiary is currently involved in any legal proceedings or arbitration proceedings that are deemed to have any significant negative impact on the business, its financial position or its performance.

Application of IAS 39

Future contracts or fixed price contracts are used to hedge raw material price risk. Moreover, the Group employs currency hedging on all of its transaction risks. This means that the gross contribution of every sales contract is hedged. As part of internal monitoring, the market value of all sales contracts and raw material purchases (including inventory) is valued with respect to both raw material prices and currency prices, which is not possible under IAS 39 without applying hedge accounting based on fairvalue hedging.

7KHPDMRULW\RISXUFKDVHDQGVDOHVFRQWUDFWVIRUSK\VLFDOGHOLYHU\DUHGHHPHGWREHGHULYDWLYHLQVWUXPHQWVDQGDUHYDOXHGDW fair value in the income statement. See also note 2.

Pension obligations

The present value of pension obligations depends on multiple factors determined on an actuarial basis using a number of assumptions. The assumptions used to determine net cost (income) for pensions include the discount rate. Each change in these assumptions will affect the carrying amount of pension obligations.

The Group determines a suitable discount rate at the end of each year. This is the rate used to determine the present value of assessed future payments that are expected to be demanded to settle the pension obligations. When determining a suitable discount rate, the Group considers the interest rates of high-quality mortgage bonds that are denominated in the currency in which the benefits will be paid, and that have terms of maturity equivalent to the assessments for the pension obligation in question.

Restructuring

A provision for restructuring is recognized when the Group has adopted a comprehensive and formal restructuring plan, and the restructuring has either been started or published. No provisions are made for future operating expenses.

NOTE 5 – AUDITORS' REMUNERATION (SEK THOUSAND)

Group Parent
2016 2015 2016 2015
Audit
PwC 7,259 6,752 1,250 1,078
Other 409 280 - -
Subtotal, audit 7,668 7,032 1,250 1,078
Other audit assignments
PwC 521 1,428 - -
Other - - - -
Subtotal, other audit assignments 521 1,428 - -
Tax consulting
PwC 979 1,272 - -
Other - 25 - -
Subtotal, tax consulting 979 1,297 - -
Other assignments
PwC 4,520 10,793 1,616 8,207
Other - 101 - -
Subtotal, other assignments 4,520 10,894 1,616 8,207
Total 13,688 20,651 2,866 9,285

The audit assignment refers to fees for the statutory audit, i.e. work that has been necessary in order to issue the Auditors' Report, and what is referred to as audit consulting, which is submitted in conjunction with the audit assignment.

NOTE 6 – EMPLOYEE BENEFITS (SEK THOUSAND)

Group Parent
2016 2015 2016 2015
Wages and salaries 1,306,390 1,199,644 67,287 58,790
Social security contributions 342,174 324,581 31,947 26,907
(of which pension costs) (125,483) (101,692) (9,557) (9,305)

SEK 5 million (5) of the Group pension costs relates to the Board of Directors, the CEO and other senior managers.

Salaries and other remuneration for members of the Board of Directors and others:

2016
Board of Directors, CEO
and other senior managers
2016
2015
Board of Directors, CEO
and other senior managers
Other
employees
Wages and
salaries
Of which
variable
remunera
Wages and
salaries
Wages and
salaries
Of which
variable
remunera
Wages and
salaries
tion tion
Parent, Sweden 41,313 15,409 25,974 27,870 11,311 30,920
Subsidiaries, Sweden 2,172 442 274,598 1,323 189 278,307
43,485 15,851 300,572 29,193 11,500 309,227
Foreign subsidiaries: 41,265 12,466 921,068 35,072 4,475 826,152
Group total 84,750 28,317 1,221,640 64,265 15,975 1,135,379

NOTE 7 – AVERAGE NUMBER OF EMPLOYEES, ETC.

Average number 2016 2016 2016
of employees Number of Of which Of which Number of Of which Of which
employees men women employees men women
Parent, Sweden 31 21 10 25 17 8
Subsidiaries in Sweden 531 401 130 543 408 135
562 422 140 568 425 143
Foreign subsidiaries:
USA 469 357 112 392 304 88
United Kingdom 416 328 88 426 338 88
Mexico 371 302 69 371 302 69
India 292 265 27 284 257 27
Denmark 187 141 46 192 142 50
Colombia 149 100 49 147 90 57
Netherlands 87 69 18 84 67 17
Belgium 85 67 18 92 73 19
Brazil 82 60 22 34 22 12
China 69 46 23 38 21 17
Turkey 45 32 13 44 33 11
Benin 33 32 1 36 35 1
Burkina Faso 31 25 6 25 20 5
Malaysia 23 7 16 23 7 16
Uruguay 14 6 8 14 6 8
Russia 14 4 10 13 5 8
Ghana 11 11 - 10 10 -
Singapore 9 4 5 4 3 1
Ivory Coast 4 4 - 4 4 -
Poland 4 2 2 4 2 2
Lithuania 3 1 2 2 1 1
Japan 3 2 1 - - -
Czech Republic 2 1 1 2 1 1
Germany 2 1 1 1 - 1
Mali 2 1 1 - - -
Norway 1 1 - 1 1 -
Group total 2,408
2,970
1,869
2,291
539
679
2,243
1,744
2,169
499
642
2016 2016
Board members and Total on Of which Total on Of which
senior managers reporting date men (%) reporting date men (%)
Group (incl. subsidiaries)
Board members 152 80 157 80
Chief Executive Officer and other senior
managers 39 92 38 92
Parent company
Board members 1) 6 50 6 50
Chief Executive Officer and other
senior managers 5 80 6 66
Chief Executive Officer and other

1) And two employee representatives, one of which is male.

127(±5(081(5\$7,212)7+(%2\$5'2)',5(&7256\$1'6(1,25(;(&87,9(6

Principles

The principles for the remuneration of senior managers (Group management) at AAK, in both the Parent company and the Group, are designed to ensure that AAK can offer internationally competitive remuneration that can attract and retain qualified managers.

Consideration and determination

Compensation of the Chief Executive Officer and other senior managers is considered by the Remuneration Committee of the Board of Directors and all decisions are made by the Board as a whole.

Components of remuneration

Total remuneration includes salary, annual variable remuneration, pension, car allowance, and termination benefit.

Salary

Fixed salary, individually determined and differentiated according to responsibility and performance, is determined on competitive principles and reviewed annually. The applicable date for the annual performance review is January 1.

Variable remuneration

Annual variable remuneration is based on meeting set targets determined on an annual basis. These targets are related to the performance of the Company. Senior management are entitled to up to 110 percent of their annual fixed salary in variable remuneration.

Pension

Pensions for senior management are in line with the Swedish KTP plan (corresponding to ITP).

Termination benefits

The Company has separate agreements with the Chief Executive Officer and senior managers for termination compensation of one year's salary (fixed cash amount per month x 12 months) on termination by the Company. Neither the Chief Executive Officer nor any senior manager can independently assert the right to termination compensation.

The period of notice of termination by the Chief Executive Officer and senior managers is agreed as 6 months. Termination notice by the Company is agreed as 12 months.

Compensation of Board Members

Fees are paid to the elected members of the Board in accordance with a resolution of the Shareholder's Annual General Meeting. This is distributed between the members as decided by the Board of Directors.

No other compensation or benefits have been paid to members of the Board, except travel expenses. The CEO, the secretary to the Board and employee representatives to the Board do not receive any compensation other than for costs in connection with their participation in Board activities.

Under a resolution of the Annual General Meeting, total compensation of elected external members of the Board is set at SEK 2,580,000, including compensation for committee work. Of this amount, the Chairman receives SEK 650,000 and each other external member receives SEK 320,000. Compensation for committee work is distributed, in accordance with a decision of the AGM, as SEK 250,000 to the Chairman of the Audit Committee, SEK 125,000 to other members of the Audit Committee, SEK 100,000 to the Chairman of the Remuneration Committee, and SEK 50,000 to other members of the Remuneration Committee.

Remuneration and other benefits for the year1)

Salary/Board of Annual Other
SEK Directors' fees variable salary benefits2) Pension cost Total
Board of Directors
Melker Schörling, Chairman 750,000 - - - 750,000
Ulrik Svensson 620,000 - - - 620,000
Lillie Li Valeur 445,000 - - - 445,000
Marianne Kirkegaard 320,000 - - - 320,000
Märta Schörling Andreen 445,000 - - - 445,000
Subtotal for Board - - -
Senior Managers
Total 5)
Subtotal, senior managers 47,270,696 4)
Other senior managers 37,678,136 24,905,249 3) 4,056,978 4,125,014 70,765,377
Arne Frank, Chief Executive Officer 9,592,560 7,693,386 3) 209,820 2,653,698 20,149,464

1) Refers to items carried as an expense in 2016.

2) Other benefits refer primarily to company cars.

3) Charged in the income statement in 2016 and estimated to be paid in 2017. During the year, variable remuneration expensed in 2015 of SEK 21,503,868 was paid.

4) Refers to the following for 2016: Anne Mette Olesen, Carla Leilani Packness, (to September 2016), David Smith, Fredrik Nilsson, Gerardo Garza López de Hereida, Jan Lenferink, Jens Wikstedt, Karsten Nielsen, Octavio Díaz de Léon, Renald Mackintosh, René Schou (as from June 2016), Terry Thomas and Torben Friis Lange.

5) Of the amount of SEK 93,494,841 SEK 44,884,170 relates to the Parent company, AAK AB.

Arne Frank, President and Chief Executive Officer, is currently paid an annual fixed salary of SEK 9,592,560 plus the value of a company car. In addition, variable remuneration may be paid up to a maximum of 110 percent of the fixed salary. In 2016, SEK 7,693,386 was carried as an expense for variable remuneration. Arne Frank's retirement age is 65. To fund the pension obligation, the Company pays annual premiums to a selected insurance company. This premium is set in the Company's agreement with Arne Frank at 30 percent of his annual fixed salary. The retirement age for other senior managers is 65 years. 65

NOTE 9 – PROVISIONS FOR PENSIONS AND SIMILAR OBLIGATIONS

Defined benefit plans

The Group maintains defined benefit retirement plans in which employees earn the right to payment of benefits after completing their employment, based on their final salary and period of service. These defined benefit retirement plans exist in Sweden, the Netherlands, Belgium and India. There are further commitments for retirement and survivors' pensions for salaried employees in Sweden that are insured through Folksam (Folksam cooperative occupational pensions).

The obligations for retirement and survivors' pension for salaried employees in Sweden are insured through policies with Alecta or correspondingly in Folksam (Folksam cooperative occupational pensions). According to a statement by the Swedish Financial Reporting Board, UFR 3, classification of ITP plans financed via insurance with Alecta, this is a defined benefit plan that involves several different employers. For the period from January 1 to December 31, 2016 AAK AB (publ.) and AAK Sweden AB have not had access to sufficient information to recognize their proportional shares of the plan's obligations, plan assets and costs, which has meant that it has not been possible to recognize the plan as a defined benefit plan. The ITP 2 pension plan that is insured through Folksam is therefore recognized as a defined contribution plan. The premium for the defined benefit retirement and survivors' pension is calculated individually and depends on factors including salary, pension earned previously and expected remaining period of service. Charges for ITP 2 pensions insured through Folksam (Folksam cooperative occupational pensions) are SEK 14 million (14 million).

The collective consolidation level consists of the market value of Alecta's assets as a percentage of the estimated insurance commitments, computed using Alecta's actuarial methods and assumptions, which are not in accordance with IAS 19. The collective consolidation level should normally be permitted to vary between 125 and 155 percent. If Alecta's collective consolidation level is below 125 percent or above 155 percent, measures must be taken to create the conditions for the consolidation level to return to the normal range. If the consolidation is low, one measure may be to increase the agreed price for new policies and increasing existing benefits. If the consolidation is high, one measure may be to introduce premium reductions. At year-end 2016, Alecta's and Folksam's surplus in the form of their collective consolidation levels was 149 percent and 186 percent, respectively (153 percent and 119 percent, respectively).

The Group has defined benefit pension plans in Sweden and the Netherlands which come under largely similar regulations. All plans are pension plans based on final salary and give employees covered by the plans benefits in the form of a guaranteed level of pension payments during their lives. The level of the benefits depends on the employees' period of service and salary on retirement. The pension payments in the Swedish and Dutch plans are normally indexed according to the consumer price index. 7KHSODQVDUHVXEMHFWWRODUJHO\VLPLODUULVNV%HQHILWVDUHSDLGIURPSODQVWKDWDUHVHFXUHGZLWKIRXQGDWLRQV7KHDFWLYLWLHVRIWKH foundations are regulated by national regulations and practice which also apply to the relationship between the Group and the administrator (or equivalent) of the foundation's plan assets. Responsibility for monitoring the plans, including investment deci-VLRQVDQGFRQWULEXWLRQVLVKHOGMRLQWO\E\WKHFRPSDQ\DQGWKHIRXQGDWLRQ¶VERDUG

Defined benefit plans
2016
The amounts recognized in the consolidated balance sheet are determined
as follows:
Present value of funded obligations 796 662
Fair value of plan assets -662 -534
134
Defined benefit plans
2016
The amounts recognized in consolidated comprehensive income are as follows:
Costs pertaining to service during the current year 20 17
Interest expenses 17 15
Interest income -14 -12
Employees' contributions paid -2 -
Total, included in employee costs (Note 6) 21 20
Pension costs
2016
Total pension costs recognized in the consolidated income statement are as follows:
Total costs for defined contribution plans including employer's contribution 104 82
Total 104
Defined benefit plans
2016
Movement in the net liability recognized in the consolidated balance sheet:
Net liability at start of year 128 149
Net cost recognized in the income statement 21 20
Benefits paid -9 -9
Disbursement of funds from the foundation 9 -
Contributions by employer to funded obligations -24 -10
Revaluation of defined benefit pension plans based on changed assumptions -5 -19
Exchange rate differences on foreign plans 4 -3
Reclassifications 10 -
Total pension costs recognized in the consolidated income statement are as follows:

Net liability at year-end 134

Defined benefit plans
2016
Asset distribution in foundation on reporting date (%):
Fixed income 36 27
Shares 19 15
Properties 5 4
Alternative investments 40 54

The entire pension obligation in the Netherlands concerns alternative investments.

Defined benefit plans
2016 2016
The Netherlands Sweden
The principal actuarial assumptions used on reporting date (%):
Discount rate 1.80 3.00
Future annual salary increases 2.35 2.80
Future annual pension increases 1.00 2.80
Employee turnover 4.00 5.00
Defined benefit plans
The Netherlands Sweden
The principal actuarial assumptions used on reporting date (%):
Discount rate 2.30 2.50
Future annual salary increases 2.50 2.50
Future annual pension increases 1.15 2.50
Employee turnover 4.00 5.00

Charges for plans for retirement benefits are expected to amount to SEK 23 million in the 2017 financial year.

The weighted average term of the pension obligation is 17–19 years.

127(±27+(523(5\$7,1*,1&20(

Group Parent
2016 2016
Insurance compensation - 28 - -
Divestment of subsidiary - 46 - -
Other operating income 109 120 0 0
Total 109 194 0 0

NOTE 11 – FINANCIAL ITEMS

Group Parent
2016 2016
Interest income 6 3 - -
Share of profit in associated companies 10 11 - -
Other financial income 0 0 - -
Group contributions - - 63 125
Financial income 16 14 63
Interest expenses -159 -99 0 -2
Changes in exchange rates -7 -10 - -
Other financial expenses -20 -19 -4 -2
Financial expenses -4 -4
Net financial items -170 -114 121

127(±7\$;(;3(16(6

Tax expenses for the year

Group
Parent
2016 2016
Current tax -453 -290 -5 -1
Deferred tax 48 -60 - -
Total -1

Determination of the current tax expense

The Group's weighted average underlying tax rate is approximately 27–28 percent. The Group's weighted average tax rate for

2016, based on the tax rates in each of the various countries involved, was 28 percent. The tax rate in Sweden is 22 percent (22).

Group Parent
2016 2016
Profit before taxes 1,445 1,295 -14 1
Weighted average tax rate
based on the tax rates in each country -384 -342 3 0
Tax effect of non-deductible expenses -22 -32 -3 -1
Tax effect of tax-exempt income 12 24 - -
Net effect of loss carry-forwards -28 -1 - -
Effect of tax rate changes 2 1 - -
\$GMXVWPHQWIRUFXUUHQWWD[IRUSUHYLRXV\HDUV 15 - -5 -
Tax expense -1

Deferred tax asset/provisions for deferred tax

Deferred tax assets and liabilities are offset when there is a legally enforceable right to offset the recognized tax assets and liabilities and when the deferred taxes refer to the same tax authority. The offset amounts are as follows:

Group Parent
Deferred tax assets 2016 2016
Tax loss carry-forwards 23 17 - -
Non-current assets 60 19 - -
Inventory 10 3 - -
Current assets -26 -22 - -
Provisions 66 45 - -
Non-current liabilities 3 11 - -
Current liabilities 65 24 - -
At year-end 201 97 - -
Group Parent
Deferred tax liabilities 2016 2016
Non-current assets 515 452 - -
Inventory 11 7 - -
Current assets 1 3 - -
Provisions -18 -19 - -
Untaxed reserves - - - -
Non-current liabilities 1 1 - -
Current liabilities 10 10 - -
At year-end - -

Deferred tax asset not recognized

The Company has no loss carry-forwards not reflected in deferred tax assets.

Income tax liabilities and tax assets

In addition to deferred tax assets and liabilities, AAK has the following current tax liabilities and tax receivables:

Group Parent
2016 2016
Current tax liabilities -357 -311 0 0
Current tax receivables 219 239 6 5
Income tax liabilities/tax assets -72 6

NOTE 13 – EARNINGS PER SHARE

Group
2016 2015
Earnings attributable to shareholders of the Parent (SEK million) 1,003 933
Weighted average number of ordinary shares in issue 42,288,489 42,079,102
Earnings per share, SEK 23.71 22.17
Earnings per share after dilution, SEK 23.71 22.12
Earnings per share after full dilution, SEK 23.71 22.16

Earnings per share are calculated for 2016 based on net profit for the year attributable to shareholders in the Parent – SEK 1,003 million (933) – and on a weighted average number of ordinary shares in issue of 42,288,489 (42,079,102).

The number of shares in the Company increased by 569,400 in 2015 with the exercise of stock options to subscribe for new shares in the Company. The option to subscribe for new shares under the incentive program adopted previously ended on December 1, 2015.

The calculation of earnings per share is based on a weighted average number of outstanding shares after dilution resulting from outstanding stock options in accordance with IAS 33.

Earnings per share after full dilution have been calculated by dividing the profit for the period by the total number of shares in issue during the period, and by converting all outstanding share options to ordinary shares.

NOTE 14 – EVENTS AFTER THE BALANCE SHEET DATE

For the 2016 financial year, the Board of Directors and Chief Executive Officer propose the distribution of a dividend in the amount of SEK 8.75 per share. A decision will be made at the Annual General Meeting on May 17, 2017. It is proposed that the record date for the dividend will be May 19 and the dividend is expected to be distributed to shareholders by May 24.

127(±,17\$1*,%/(\$66(76

Group Goodwill assets Total
Cost at January 1, 2015 1,327 320 1,647
Investments - 25 25
Acquired through business combination 230 256 486
Exchange differences 10 -4 6
\$FFXPXODWHGFRVWDW'HFHPEHU 2,164
Cost at January 1, 2016 1,567 597 2,164
Patents
and other
intangible
Group Goodwill assets Total
Cost at January 1, 2015 1,327 320 1,647
Investments - 25 25
Acquired through business combination 230 256 486
Exchange differences 10 -4 6
\$FFXPXODWHGFRVWDW'HFHPEHU 2,164
Cost at January 1, 2016 1,567 597 2,164
Investments - 11 11
Acquired through business combination 46 - 46
Disposals - -6 -6
Reclassifications - -9 -9
Exchange differences 73 15 88
Accumulated cost at December 31, 2016 2,294
Amortization and impairment loss at January 1, 2015 0 193 193
Impairment losses for the year - 28 28
Exchange differences - -1 -1
\$FFXPXODWHGDPRUWL]DWLRQDQGLPSDLUPHQWORVVDW'HFHPEHU 0 220 220
Amortization and impairment loss at January 1, 2016 0 220 220
Impairment losses for the year - 34 34
Disposals - -6 -6
Exchange differences - 3 3
Accumulated amortization and impairment loss at December 31, 2016 0
5HVLGXDOYDOXHDW'HFHPEHU 377 1,944
Residual value at December 31, 2016 2,043
2015
512
74
58
651
45
227
1,567

Reviewing impairment of goodwill

In preparing the financial statements for 2016, the Group has reviewed impairment of goodwill. Goodwill is allocated to cash-generating units. The recoverable amount for a cash-generating unit is determined by calculating its value in use. These calculations are based on estimated future cash flow as stated in budgets and forecasts covering a five-year period. Cash flow beyond this period has been extrapolated by no more than 3 percent (3) in any case. Working capital beyond the five-year period is estimated at the same level as year five. Discount rates are assumed to be 9 percent (9) after tax and 12.8 percent (12.8) before tax. Goodwill testing of the Swedish, Danish, Belgian and Dutch units was done at an aggregate level, whereby the four production units were considered as a single cash-generating unit. Other goodwill testing considered cash-generating units at country level. Approximately 35 percent of goodwill is attributable to the business area Chocolate & Confectionery Fats and the remaining approximately 65 percent to Food Ingredients.

Testing has not demonstrated any need for impairment. The sensitivity in these calculations indicates that recognized goodwill is still intact even if the discount rate increases by 1 percent or if long-term growth is 1 percent less.

Goodwill by cash-generating unit

2016
Scandinavia, including Belgium and the Netherlands 535 512
United Kingdom 66 74
Turkey 52 58
USA 700 651
Colombia 51 45
Mexico 43 -
India 239 227
Total

NOTE 16 – PROPERTY, PLANT AND EQUIPMENT

Land and Plant and Equipment,
tools and
fixtures and
Non-current
assets
under con
Group buildings machinery fittings struction Total
Cost at January 1, 2015 1,763 6,891 506 615 9,775
Investments 31 360 77 501 969
Acquired through business combinations 20 50 0 13 83
Disposals -183 -50 -33 -1 -267
Reclassifications 52 60 6 -122 0
Exchange differences -28 -39 -10 -64 -145
\$FFXPXODWHGFRVWDW'HFHPEHU 7,272 942
Cost at January 1, 2016 1,655 7,272 546 942 10,415
Investments 29 322 31 579 961
Acquired through business combinations 79 411 8 3 501
Disposals - -89 -38 - -127
Reclassifications 49 117 22 -179 9
Exchange differences 39 75 7 129 250
Accumulated cost at December 31, 2016 1,474 12,009
Depreciation at January 1, 2015 990 4,567 372 - 5,929
Disposals -127 -46 -31 - -204
Depreciations for the year 43 325 35 - 403
Exchange differences -11 -27 -4 - -42
\$FFXPXODWHGGHSUHFLDWLRQDW'HFHPEHU 895 4,819 372 - 6,086
Depreciation at January 1, 2016 895 4,819 372 - 6,086
Acquired through business combinations 58 299 6 - 363
Disposals - -83 -36 - -119
Reclassifications 5 -5 - - 0
Depreciations for the year 45 348 37 - 430
Exchange differences 17 30 4 - 51
Accumulated depreciation at December 31, 2016 1,020 -
Impairment loss at January 1, 2015 12 22 - - 34
Exchange differences 1 -1 - - 0
Accumulated impairment loss at
'HFHPEHU 13 21 - - 34
Impairment loss at January 1, 2016 13 21 - - 34
Exchange differences -1 1 - - 0
Accumulated impairment loss at
December 31, 2016
12 22 - - 34
Residual value according to plan at
'HFHPEHU
747 2,432 174 942
of which land 125
Residual value according to plan
at December 31, 2016
193 1,474
of which land 150

NOTE 17 – INVESTMENTS IN GROUP COMPANIES

Parent
2016
Start of year 2,421
2,421
Formation of subsidiaries 5 -
Accumulated cost 2,426 2,421

List of shareholdings and book value as of December 31, 2016

2016
Book Book
Domicile No. of shares Capital % value No. of shares Capital % value
AarhusKarlshamn Invest AB, Sweden Malmö 1,000 100 0 1,000 100 0
AAK Colombia, Colombia Bogotá 2,079,740 100 2,079,740 100
AAK Belgium N.V., Belgium Brussels 100 100
AAK Zhangjiagang Ltd, China Zhangjiagang - 100 - 100
AarhusKarlshamn Finance AB, Sweden Malmö 100,000 100 472 100,000 100 472
AarhusKarshamn Holding AB, Sweden Malmö 1,000 100 481 1,000 100 481
AAK Kamani Pvt Ltd, India Mumbai
AAK Sweden AB, Sweden Karlshamn 100 100
AAK Netherlands BV, the Netherlands Zaandijk 100 100
AAK Denmark Holding A/S, Denmark Aarhus 400,000,000 100 1,468 400,000,000 100 1,468
AAK Denmark A/S, Denmark Aarhus 100,000,000 100 100,000,000 100
AarhusKarlshamn Latin America S.A., Uruguay Cousa 100 100
AAK do Brasil Indústria e Comércia de Óleos
Vegetais Ltda, Brazil
São Paulo 24,000 100 24,000 100
AAK (UK) Ltd, United Kingdom +XOO 23,600,000 100 23,600,000 100
AAK USA Inc., USA New Jersey 20,300,000 100 20,300,000 100
AAK Mexico, S.A. de C.V., Mexico Morelia 201,006,799 99.9976 201,006,799
AAK Miyoshi JP, Japan Tokyo - 70 5 - -
Total 2,426 2,421

The list includes certain shares and ownership interests owned by the Parent, either directly or indirectly, as of December 31, 2016. A complete listing of all holdings of shares and interests prepared in accordance with the rules of the Swedish Annual Accounts Act and which is included in the annual reports filed with the Swedish Companies Registration Office can be requested from AAK AB, Corporate Communications, Skrivaregatan 9, 215 32 Malmö, Sweden.

127(±,19(1725,(6

Group
2016
Raw materials and consumables 2,737 2,099
Goods in transit 511 371
Work in progress 894 561
Finished products and goods for resale 708 568
Total according to balance sheet
Change in fair value 245 116
Inventory at fair value

´5DZPDWHULDOVDQGFRQVXPDEOHVDQGFKDQJHVLQLQYHQWRULHVRIILQLVKHGSURGXFWVDQGZRUNLQSURJUHVV´IRUWKH*URXSLQFOXGHV impairment loss on inventories of SEK 7 million (19).

127(±&\$6+\$1'&\$6+(48,9\$/(176

Group
2016
Cash equivalents 552 447
Current investments 34 12
Total

127(±6+\$5(+2/'(56¶(48,7<

*URXS

6KDUHFDSLWDO

As of December 31, 2016 the Group's registered share capital was 42,288,489 shares (SEK 422,884,890).

5HVHUYHV

Translation reserve

Translation reserves include all exchange differences that arise when translating financial statements from foreign operations whose financial statements are stated in currencies other than the Group's presentation currency. The Parent company and the Group present their financial statements in SEK.

Hedging reserve

The hedging reserve encompasses the effective portion of the accumulated net change in the fair value of a cash flow hedging instrument attributable to hedging transactions yet to take place.

Statutory reserve

The statutory reserve refers to a reduction of the share capital carried out previously.

Retained profits and profit for the year

Retained profits and profit for the year include profits earned and retained by the Parent and subsidiaries, investments in associates, revaluation of the net pension commitment, new share issue, net effect of acquisition of minority share and profit for the year.

Treasury shares

The Group owned a total of 0 (0) treasury shares as of December 31, 2016.

6SHFLILFDWLRQRIHTXLW\LWHP³5HVHUYHV´

6WDWXWRU\ +HGJLQJ 7UDQVODWLRQ
UHVHUYH UHVHUYH UHVHUYH 7RWDO
2015 opening balance 5 -12 195 188
Exchange differences - - 48 48
Cash flow hedges recognized in "Other comprehensive income" - 25 - 25
7D[RQFDVKIORZKHGJHVUHFRJQL]HGLQ´2WKHUFRPSUHKHQVLYHLQFRPH´ - -6 - -6
FORVLQJEDODQFH
2016 opening balance 5 7 243 255
Exchange differences - - 188 188
Cash flow hedges recognized in "Other comprehensive income" - 23 - 23
7D[RQFDVKIORZKHGJHVUHFRJQL]HGLQ´2WKHUFRPSUHKHQVLYHLQFRPH´ - -5 - -5
FORVLQJEDODQFH

*3DUHQWFRPSDQ*

6KDUHFDSLWDO

In accordance with the articles of association for AAK AB (publ.), share capital shall be a minimum of SEK 300 million and a maximum of SEK 1.2 billion. All shares are fully paid and entitle the holder to equal voting rights and shares in Company assets. Share capital consists of 42,288,489 shares (42,288,489) at a quota value of SEK 10 per share, and shareholder equity of SEK 422,884,890 (422,884,890).

6WDWXWRU\UHVHUYH

The statutory reserve refers to a reduction of the share capital carried out previously.

5HWDLQHGSURILW

Retained profit includes non-restricted equity from the previous year after any dividend distribution. This comprises profit for the year and new share issue, total non-restricted equity, i.e. the amount available for dividends to shareholders.

'LYLGHQG

In accordance with the Swedish Companies Act, the Board of Directors proposes payment of a dividend, for the consideration and approval of the Annual General Meeting of the Shareholders. The proposed dividend for payment in 2016 is SEK 370 million (SEK 8.75 per share), which has not yet been considered by the Annual General Meeting. This amount is not recognized as a liability.

3URSRVHGDSSURSULDWLRQRISURILWV

7KH%RDUGRI'LUHFWRUVDQG&KLHI([HFXWLYH2I¿FHUSURSRVHWKDW

7KHGLVSRVDEOHSUR¿WEURXJKWIRUZDUG SEK 3,834,015,571
DQGSUR¿WORVVIRUWKH\HDU 6(.
Total SEK 3,814,884,025
be appropriated as follows:
To be distributed to shareholders, a dividend of SEK 8.75 per share SEK 370,024,279 1)
To be carried forward SEK 3,444,859,746
Total SEK 3,814,884,025

1) Calculated on the number of outstanding shares as at the balance sheet date.

127(±%2552:,1*6

*URXS 3DUHQW
1RQFXUUHQW
Liabilities to banks and credit institutions 2,857 2,132 - -
7RWDO
*URXS 3DUHQW
&XUUHQW
Liabilities to banks and credit institutions 217 287 - -
7RWDO

Maturity for non-current borrowing is as follows:

*URXS 3DUHQW
Between 1 and 5 years 2,356 1,807 - -
More than 5 years 501 325 - -
7RWDO

127(±27+(53529,6,216

*URXS 5HVWUXF
WXULQJ
(QYLURQ
PHQWDO
UHVWRUDWLRQ
2WKHU 7RWDO
Opening balance at January 1, 2015 75 26 130 231
Provisions for the year - - 47 47
Provisions claimed for the year -42 - -61 -103
Acquired through business combinations - - 38 38
Exchange differences 1 -1 -1 -1
&ORVLQJEDODQFHDVDW'HFHPEHU
(QYLURQ
*URXS 5HVWUXF
WXULQJ
PHQWDO
UHVWRUDWLRQ
2WKHU 7RWDO
Opening balance at January 1, 2016 34 25 153 212
Provisions for the year - - 45 45
Provisions claimed for the year -10 - -64 -74
Exchange differences -1 1 8 8
&ORVLQJEDODQFHDVDW'HFHPEHU
3URYLVLRQVLQFOXGH
Non-current 70 62
Current 121 150
7RWDO

5HVWUXFWXULQJ

A provision for restructuring is reported when the Group has adopted a comprehensive and formal restructuring plan, and the restructuring has either been started or published. No provisions are made for future operating expenses.

(QYLURQPHQWDOUHVWRUDWLRQ

These provisions are primarily related to restoring contaminated land.

127(±\$&&58('(;3(16(6\$1''()(55(',1&20(

*URXS 3DUHQW

Employee-related expenses 309 242 29 31
Other 590 430 10 4
7RWDO

NOTE 24 – ASSETS PLEDGED

Group Parent
2016 2015 2016 2015
Collateral for provisions and liabilities
Property mortgages 525 547 - -
Other assets 334 289 - -
Total 859 836 - -

NOTE 25 – CONTINGENT LIABILITIES

Group Parent
2016 2015 2016 2015
Other contingent liabilities 1,547 655 1,547 655
Total 1,547 655 1,547 655

Contingent liabilities refer primarily to counter-guarantees issued for Group companies' commitments to financial institutions to cover local borrowings.

Over and above the contingent liabilities stated above, guarantees for the completion of various contractual undertakings are sometimes involved as part of the Group's normal business activities. There was no indication at year-end that any contractual guarantees provided will require any payment to be made.

NOTE 26 – RELATED-PARTY TRANSACTIONS

For the Parent, SEK 95 million (80), i.e. 100 percent (100) of sales were to Group companies. The Parent's purchasing from Group companies is related to administrative services of limited scope. All transactions were carried out on commercial terms.

Transactions with key management personnel

Besides those transactions stated in Note 8 Remuneration of the Board of Directors and Senior Executives and in the description of the Board of Directors on pages 28–29, no transactions with related physical persons have taken place.

NOTE 27 – ACQUISITIONS

California Oils Corporation

During the third quarter, AAK acquired all shares in California Oils Corporation, the leading company in speciality and semispeciality oils on the US West Coast, from Mitsubishi Corporation of Japan. The company has an annual volume of approximately 110,000 MT and had sales of approximately SEK 1,350 million in the last financial year. The company has 65 employees.

The assets and liabilities recognized as a consequence of the acquisition are as
follows:
Fair value
(SEK million)
Tangible assets 138
Financial assets 3
Inventories 368
Other current assets 115
Cash and cash equivalents 114
Provisions -19
Other current liabilities -184
Total net assets 535
Goodwill -15
Total acquisition with cash and cash equivalents 520
Net outflow of cash and cash equivalents on account of the acquisition
Cash and cash equivalents paid for the acquisition 520
Cash and cash equivalents in the company acquired at the acquisition date -114

Cash and cash equivalents in the company acquired at the acquisition date -114 Impact on the Group's cash and cash equivalents 406

The company forms part of AAK's sales and operating profit as from September 1, 2016. The acquisition had very limited impact on AAK's operating profit for 2016.

127(±6(*0(175(3257,1*

The Group's operations are organizationally divided into business segments based on product. The marketing organization also reflects this structure.

All transactions between business segments are recognized at market value. Assets and liabilities not attributed to a segment include tax assets and tax liabilities, financial investments and financial liabilities, as well as cash and cash equivalents and interest-bearing receivables.

The external sales are based on where our customers are located. The carrying amounts of assets and the direct investment in plant for the period are determined by the location of the assets. The Group has applied hedge accounting based on fair-value hedging.

6HJPHQWEDVHGUHSRUWLQJLVSUHSDUHGLQDFFRUGDQFHZLWKWKHDFFRXQWLQJSROLFLHVGHVFULEHGLQ1RWH´\$FFRXQWLQJ3ROLFLHV´

Reporting by primary segments/business areas

2016 Food
Ingredients
Chocolate &
Confectionery
Fats
Technical
Products &
Feed
Group
Functions
Eliminations Group
Net sales
External sales 14,707 6,117 1,233 - - 22,057
Internal sales 1,512 2,662 46 - -4,220 -
Group total 16,219 1,279 - -4,220

Operating profit/loss by business segment

2016 Food
Ingredients
Chocolate &
Confectionery
Fats
Technical
Products &
Feed
Group
Functions
Eliminations Group
Operating profit/loss 996 664 100 -145 - 1,615
Total 996 664 100 -
Other
Assets 9,082 6,103 856 105 - 16,146
Unallocated assets - - - - 1,038
Group total 6,103 -
Liabilities 2,920 1,644 468 270 - 5,302
Unallocated liabilities - - - - - 4,306
Group total 2,920 1,644 270 -
Investments 413 520 33 6 - 972
Depreciation,
amortization and
impairment loss 247 176 39 2 - 464

Reporting by market

2016 Sweden Denmark Other
Nordic
countries
Central
and
Eastern
Europe
Western
Europe
North
and
South
America
Asia Other
countries
Total
External sales 1,840 362 754 1,851 5,326 8,578 3,064 282 22,057
Intangible assets and
property, plant and
equipment 1,070 1,212 - 0 914 2,851 1,004 156 7,207
Other assets 2,102 911 4 102 1,504 3,421 851 1,082 9,977
Total assets 3,172 2,123 4 102 6,272
Investments 99 99 - 0 128 335 303 8 972

Reporting by primary segments/business areas

Food
Ingredients
Chocolate &
Confectionery
Fats
Technical
Products &
Feed
Group
Functions
Eliminations Group
Net sales
External sales 13,556 5,315 1,243 - - 20,114
Internal sales 1,219 2,263 55 - -3,537 -
Group total - 20,114

Operating profit/loss by business segment

Food Chocolate &
Confectionery
Technical
Products &
Group
Ingredients Fats Feed Functions Eliminations Group
Operating profit/loss 903 553 88 -133 - 1,411
Total 903 -133 - 1,411
Other
Assets 7,213 4,933 812 91 - 13,049
Unallocated assets - - - - 847
Group total 7,213 4,933 91 -
Liabilities 1,987 1,058 480 222 - 3,747
Unallocated liabilities - - - - - 3,499
Group total 222 - 7,246
Investments
Depreciation, amortization
310 621 59 4 - 994
and impairment loss 221 167 39 4 - 431

Reporting by market

Sweden Denmark Other
Nordic
countries
Central
and
Eastern
Europe
Western
Europe
North
and
South
America
Asia Other
countries
Total
External sales 2,035 350 809 1,386 5,568 7,692 857 1,417 20,114
Intangible assets
and property, plant
and equipment 1,128 1,179 - 1 903 2,206 752 71 6,240
Other assets 1,859 850 3 54 1,286 2,161 611 832 7,656
Total assets 2,029 3 4,367 1,363 903
Investments 174 70 - - 104 560 79 7 994

NOTE 29 – OPERATING LEASES

Future minimum leasing fees under non-cancellable operating lease agreements are distributed as follows:

Group
2016
Within 1 year 99 78
Between 1 and 5 years 226 157
More than 5 years 317 281
Total 642

Operating lease expenses of SEK 94 million (84) are recognized in profit or loss for the period.

127(±6833/(0(17\$/&\$6+)/2:67\$7(0(17

Group Parent
2016 2016
\$GMXVWPHQWIRULWHPVQRWLQFOXGHGLQFDVKIORZ
Net profit from divestment of subsidiary - -45 - -
Sales of non-current assets 3 5 - -
Changes in pensions and provisions -25 -60 - -
Non-recurrent item concerning acquisition in subsidiary -15 - - -
Total -37 -100 - -

ALTERNATIVE PERFORMANCE MEASURES (APM)

Organic volume growth

Full year Full year
% 2016 2015
Food Ingredients
Organic volume growth -2 5
Acquisitions/divestments 7 8
Volume growth as reported 5 13
Chocolate & Confectionery Fats
Organic volume growth 13 -2
Acquisitions/divestments 5 1
Volume growth as reported 18 -1
Technical Products & Feed
Organic volume growth 4 -2
Acquisitions/divestments 0 -1
Volume growth as reported 4 -3
AAK Group
Organic volume growth 2 3
Acquisitions/divestments 5 5
Volume growth as reported 7 8

EBITDA

SEK million

SEK million Full year
2016
Full year
2015
Operating profit (EBIT) 1,615 1,409
Add back depreciation and amortization 464 431
EBITDA 2,079 1,840

Return on Capital Employed (ROCE)

SEK million

SEK million Full year
2016
Full year
2015
Total assets 17,184 13,896
Cash and cash equivalents -586 -459
Financial assets -3 -8
Accounts payables -3,258 -2,383
Other non-interest-bearing liabilities -2,293 -1,571
Capital employed 11,044 9,475
Operating profit (Rolling 12 months) 1,615 1,409
Return on Capital Employed (ROCE), % 14.6 14.9

:RUNLQJFDSLWDO

)XOO\HDU )XOO\HDU
6(.PLOOLRQ
Inventory 4,850 3,599
Accounts receivables 3,027 2,426
Other current receivables, non-interest-bearing 1,277 1,016
Accounts payables -3,258 -2,383
Other current liabilities, non-interest-bearing -2,293 -1,571
:RUNLQJFDSLWDO

1HWGHEW

)XOO\HDU )XOO\HDU
6(.PLOOLRQ
Current interest-bearing receivables 3 8
Cash and cash equivalents 586 459
Pension liabilities -134 -128
Non-current liabilities to banks and credit institutions -2,857 -2,132
Current liabilities to banks and credit institutions -217 -287
Other interest-bearing liabilities -1 -3
1HWGHEW

(TXLW\WRDVVHWVUDWLR

)XOO\HDU )XOO\HDU
6(.PLOOLRQ
Shareholders' equity 7,522 6,597
Non-controlling interests 54 53
7RWDOHTXLW\LQFOXGLQJQRQFRQWUROOLQJLQWHUHVWV
7RWDODVVHWV
(TXLW\WRDVVHWVUDWLR

Corporate Governance Report

Corporate Governance Report 2016

This Corporate Governance Report has been drawn up in accordance with the rules of the Annual Accounts Act and the Swedish &RUSRUDWH*RYHUQDQFH&RGH³WKH&RGH´?7KH&RUSRUDWH *RYHUQDQFH5HSRUWKDVEHHQVXEMHFWWRWKHVWDWXWRU\UHYLHZE\ the company's auditor.

Effective and clear corporate governance contributes to the safeguarding of trust among AAK's stakeholder groups and also LQFUHDVHVWKHIRFXVRQEXVLQHVVEHQH¿WDQGVKDUHKROGHUYDOXHLQ the company. AAK's Board of Directors and management team endeavour, through a high level of transparency, to make it easy for individual shareholders to understand the company's decisionmaking process and to clarify where in the organization responsibilities and authorities reside. AAK's corporate governance is based on applicable legislation, the Code, NASDAQ OMX Stockholm's regulatory framework for issuers, generally accepted practice in the stock market and various internal guidelines. Where AAK has chosen to diverge from the rules in the Code, the reason is provided under each heading in this Corporate Governance Report.

General

AAK is a Swedish public limited liability company, the shares of which are traded on NASDAQ OMX Stockholm within the Large Cap segment, Consumer Commodities sector. AAK has around 9,600 shareholders. Its business operations are global, with a presence in more than 100 countries. As at December 31, 2016 the number of employees was 2,970. Responsibility for management and control of AAK is divided between the shareholders at the Annual General Meeting, the Board of Directors, its elected committees and the CEO in accordance with the Swedish Companies Act, other legislation and ordinances, applicable rules for companies traded on a regulated market, the Articles of Association and the Board's internal control instruments. AAK's JRDOLVWREHWKHREYLRXV¿UVWFKRLFHIRULWVFXVWRPHUVDQGWR create the best possible value for the company's various stakeholder groups – in particular customers, suppliers, shareholders and employees. At the same time, AAK aims to be a good corporate citizen and take long-term responsibility. The aim of corporate JRYHUQDQFHLVWRGH¿QHDFOHDUDOORFDWLRQRIUHVSRQVLELOLW\DQGUROHV between the owners, the Board, the executive management team and various control bodies. In line with this, corporate governance covers the Group's management and control systems.

Ownership structure

Information about shareholders and shareholdings can be found on pages 88–89.

Articles of Association

AAK's current Articles of Association were adopted at the Annual General Meeting on May 11, 2016. The Articles of Association state that the company is to operate manufacturing and trading business, primarily within the food industry, to own and manage shares and securities and other associated business. The Articles of Association also state the shareholders' rights, the number of Board members and auditors, that the Annual General Meeting VKDOOEHKHOG\HDUO\ZLWKLQVL[PRQWKVRIWKHHQGRIWKH¿QDQFLDO \HDUKRZQRWL¿FDWLRQRIWKH\$*0VKDOOEHHIIHFWHGDQGWKDWWKH UHJLVWHUHGRI¿FHRIWKH%RDUGRI'LUHFWRUVVKDOOEHLQ0DOP|

6ZHGHQ7KHFRPSDQ\¶V¿QDQFLDO\HDULVWKHFDOHQGDU\HDU7KH Annual General Meeting shall be held in Malmö or Karlshamn, Sweden. The Articles of Association contain no restrictions on the number of votes each shareholder may cast at a general meeting. Furthermore, the Articles of Association contain no special provisions on the appointment and removal of Members of the Board of Directors and on amendments to the Articles of Association. For the current Articles of Association, please see www.aak.com.

Annual General Meeting

The Annual General Meeting of AAK is the highest decision-making body and the forum through which the shareholders exercise their LQÀXHQFHRYHUWKHFRPSDQ\7KHWDVNVRIWKH\$QQXDO*HQHUDO Meeting are regulated by the Swedish Companies Act and the Articles of Association. The Annual General Meeting makes decisions on a number of central issues, such as adoption of the income statement and balance sheet, discharge from liability for the Board members and CEO, the dividend to shareholders and the composition of the Board. Further information about the Annual General Meeting and complete minutes from previous Annual General Meetings and Extraordinary General Meetings are published at www.aak.com.

Annual General Meeting 2016

The Annual General Meeting held on May 11, 2016 was attended by shareholders representing around 61 percent of the share capital and votes in the company. The Chairman of the Board, Melker Schörling, was elected Chairman of the Annual General Meeting. The AGM adopted the income statement and balance sheet, as well as the consolidated income statement and consolidated balance sheet. In association with this, the Annual General Meeting approved the Board's proposal for a dividend for the ¿QDQFLDO\HDURI6(.SHUVKDUH0HONHU6FK|UOLQJ Ulrik Svensson, Märta Schörling Andreen, Lillie Li Valeur, Marianne Kirkegaard and Arne Frank were re-elected as ordinary members of the Board of Directors. Melker Schörling was re-elected as Chairman of the Board. The employee organizations had appointed Annika Westerlund (PTK-L) and Leif Håkansson (IF Metall) as employee representative members of the Board, and Ingvar Andersson (IF Metall) and Ted Jörgensen (PTK-L) as deputy members of the Board. The Annual General Meeting did not authorize the Board to resolve on the issue of new shares by the Company or the acquisition of the Company's own shares.

Nomination Committee

The Annual General Meeting decides on the election of the Board, among other items. The task of the Nomination Committee is to make proposals to the Annual General Meeting regarding the election of the Chairman and other members of the Board and of the Chairman of the Meeting, and regarding remuneration issues and related issues.

Nomination Committee for the Annual General Meeting in 2017 At the Annual General Meeting in 2016, Mikael Ekdahl (Melker Schörling AB), Lars-Åke Bokenberger (AMF Fonder), Henrik Didner (Didner & Gerge fonder) and Johan Strandberg (SEB Investment Management) were appointed members of the Nomination Committee for the Annual General Meeting in 2017. Mikael Ekdahl was appointed Chairman of the Nomination Committee.

CORPORATE GOVERNANCE The members of the Nomination Committee represent around 48.0 percent of the votes in AAK. The decision also included the opportunity to change the composition of the Nomination Committee in the event of a change in ownership. During the year, the Nomination Committee held one minuted meeting. At this meeting, the Chairman reported on the evaluation work, whereupon the Nomination Committee discussed any changes and new recruitment. The Nomination Committee has been contactable by letter with proposals from shareholders. The members of the Nomination Committee have not received any remuneration from AAK for their work. Shareholders who wish to contact the Nomination Committee can send letters addressed to AAK AB (publ.), Valberedningen, Skrivaregatan 9, SE-215 32 Malmö, Sweden.

7KH%RDUGRI'LUHFWRUVDQGLWVDFWLYLWLHV

The tasks of the Board are regulated in the Swedish Companies Act and the Articles of Association. In addition to this, the work of the Board is regulated by the working practices adopted by the Board each year. The procedural rules of the Board also regulate the distribution of work and responsibilities between the Board, the Chairman of the Board and the CEO and also include procedures IRU¿QDQFLDOUHSRUWLQJE\WKH&(2WRWKH%RDUG\$FFRUGLQJWRWKH current working practices, the Board shall meet at least six times each year, including a statutory meeting following election held immediately after the Annual General Meeting. The tasks of the Board shall include setting strategies, business plans, budgets, interim reports and year-end reports for AAK. The Board shall also monitor the work of the CEO, appoint and dismiss the CEO and decide on important changes to AAK's organization and operation. The most important tasks of the Board are to set the overriding goals for the company's operation and to decide on the company's strategy for achieving the goals; to ensure the company has an effective executive management team and appropriate remuneration terms; to ensure the transparency and accuracy of the company's external reporting; and that external reporting provides a fair SUHVHQWDWLRQRIWKHFRPSDQ\¶VSHUIRUPDQFHSUR¿WDELOLW\DQG¿QDQ-FLDOSRVLWLRQDQGH[SRVXUHWRULVNWRPRQLWRUWKH¿QDQFLDOUHSRUWLQJ including instructions to the CEO and the establishment of require-PHQWVIRUWKHFRQWHQWRIWKH¿QDQFLDOUHSRUWLQJWREHVXEPLWWHGWR the Board on a continuous basis; to ensure the company's insider policy and logging procedures are adhered to in accordance with legislation and the guidelines of the Swedish Financial Supervisory Authority; to ensure there are effective systems for follow-up and FRQWURORIWKHFRPSDQ\¶VRSHUDWLRQDODQG¿QDQFLDOSRVLWLRQDJDLQVW set goals; to follow up and evaluate the company's development and to recognize and support the work of the CEO in carrying out WKHUHTXLUHGPHDVXUHVWRHQVXUHWKHUHLVVXI¿FLHQWFRQWURORIWKH company's compliance with legislation and other rules applicable to the operation of the company, to ensure the required ethical guidelines are set for the company's behaviour; and to propose to the Annual General Meeting any dividend, repurchase of shares, redemption or other proposals falling within the competence of the Annual General Meeting. The Chairman of the Board of Directors is responsible for evaluating the work of the Board. During 2016, he conducted surveys of the members and, based on this and LQWHUYLHZVLQWKHSUHYLRXV\HDUDQDO]HGWKHSUR¿W7KHSUR¿WZDV then presented and discussed on the Board and on the Nomination Committee as the basis for assessing the size and composition of the Board. The evaluation focused on Board work in general and on the contributions of individual members, including the Chairman of the Board and the CEO. The Board evaluations clearly contributed to continued development of the work of the Board and the committees.

&RPSRVLWLRQRIWKH%RDUG

Under the Articles of Association, AAK's Board shall consist of at least three and at most ten members. The current Board FRQVLVWVRI¿YHPHPEHUVHOHFWHGE\WKH\$QQXDO*HQHUDO0HHWLQJ Under Swedish law, employee organizations have a right to be represented on the Board, and have appointed two ordinary members and two deputies. In accordance with the proposal by the Nomination Committee, all six members were re-elected. Melker Schörling was appointed Chairman of the Board. At the statutory Board meeting following the Annual General Meeting, the Board chose to appoint an Audit Committee and a Remuneration Committee. Ulrik Svensson was appointed Chairman of the Audit Committee and Lillie Li Valeur and Märta Schörling Andreen were appointed members. Melker Schörling was appointed Chairman of the Remuneration Committee and Ulrik Svensson was appointed member. Melker Schörling is also Chairman of the Board of Melker Schörling AB (publ.), which holds around 32.9 percent of the votes in AAK. Melker Schörling cannot, therefore, be considered to be LQGHSHQGHQWLQUHODWLRQWRPDMRUVKDUHKROGHUVLQWKH&RPSDQ\ in accordance with the Code. Märta Schörling Andreen is also a member of the Board of Directors of Melker Schörling AB and cannot, therefore, be considered to be independent in relation to \$\$.¶VPDMRUVKDUHKROGHUV7KH3UHVLGHQWDQG&KLHI([HFXWLYH 2I¿FHU\$UQH)UDQNLVLQKLVFDSDFLW\DV&KLHI([HFXWLYH2I¿FHUDQG an employee of the Company, not independent in relation to the Company management. The other two members elected by the AGM, Marianne Kirkegaard and Lillie Li Valeur, are independent in relation to AAK, the Company management and the Company's PDMRUVKDUHKROGHUVLQDFFRUGDQFHZLWKWKH&RGH

7KH%RDUGWKHUHIRUHIXO¿OVWKHUHTXLUHPHQWRIWKH&RGHWKDWDW least two Board members who are independent of the Company and the Company management shall also be independent of the &RPSDQ\¶VPDMRUVKDUHKROGHUV0LNDHO(NGDKODFWVDVVHFUHWDU\ to the Board. The application and result of the diversity policy are described on the Company's website in the Nomination Committee's reasoned statement regarding proposals to the Board of AAK AB (publ.).

:RUNLQJSUDFWLFHV

The Board's working practices, containing instructions for the GLYLVLRQRIZRUNEHWZHHQWKH%RDUGDQGWKH&(2DQGIRU¿QDQFLDO reporting, are updated and adopted annually. Board meetings FRQVLGHUWKH¿QDQFLDOUHSRUWLQJDQGPRQLWRULQJRIGD\WRGD\EXVL-QHVVRSHUDWLRQVDQGSUR¿WDELOLW\WUHQGVDVZHOODVJRDOVVWUDWHJLHV IRUWKHEXVLQHVVRSHUDWLRQDFTXLVLWLRQVDQGVLJQL¿FDQWLQYHVWPHQWV and matters relating to capital structure. Business area managers and other senior executives report on business plans and strategic issues on a continual basis.

Remuneration and audit issues are prepared within the respective committees. The Board holds a statutory meeting immediately after the Annual General Meeting. At this meeting, the Board's working practices are also adopted, as are the instructions to the CEO and the Committees and other internal management instruments. The current Board held its statutory meeting on May 11, 2016 at which meeting all members were in attendance.

Chairman of the Board

At the Annual General Meeting held on May 11, 2016 Melker Schörling was elected Chairman of the Board. The role of the Chairman of the Board is to lead the work of the Board and ensure WKH%RDUGIXO¿OVLWVWDVNV7KH&KDLUPDQVKDOOPRQLWRUWKHSURJUHVV of the business in dialogue with the CEO, and is responsible for ensuring the other members continuously receive the information required to carry out the work on the Board, maintaining the required quality and in accordance with the Swedish Companies Act and other applicable laws and ordinances, the Articles of Association and the working practices of the Board. The Chairman is responsible for ensuring the Board constantly develops its knowledge about the Company, that an evaluation of the Board's work is carried out and that the Nomination Committee is provided with this evaluation. The Chairman shall also participate in evaluation and development issues relating to senior executives in the Group.

The work of the Board in 2016

The Board held eight meetings during the year. All business area managers reported on the goals and business strategies of the EXVLQHVVDUHDV7KH%RDUGKDVKDQGOHGLVVXHVUHODWLQJWRVWDI¿QJ and organization, Decisions have been made relating to investments, acquisitions and disposals. Other areas handled are the Group's work on raw materials supply, risk management and the Company's strategy for capital structure and borrowing.

Attendance at Board and committee meetings in 2016

Member Board of Directors Audit Committee Remuneration
Committee
Number of meetings 8 5 1
Marianne Kirkegaard 7
Lillie Li Valeur 8 5
Märta Schörling Andreen 8 3
Arne Frank 8
Leif Håkansson 8
Melker Schörling 8 1
Ulrik Svensson 8 5 1
Annika Westerlund 8

Information about the members of the Board can be found on pages 28–29.

Fees to Board members

According to the decision of the Annual General Meeting, the total fees to the Board amounted to SEK 2,580,000, to be allocated between the members as follows: SEK 650,000 to the Chairman and SEK 320,000 to each of the other members elected at the Annual General Meeting who are not employed by the company. The Chairman of the Audit Committee received SEK 250,000 and the members SEK 125,000 each. The Chairman of the Remuneration Committee received SEK 100,000 and the member SEK 50,000. The CEO, the secretary to the Board and employee representatives to the Board do not receive any compensation other than for costs in connection with their participation in Board activities. For further information about remuneration to members of the Board, please see page 64.

Evaluation of the CEO

The Board continuously evaluates the work and competence of the CEO and the Company's management team. This is discussed at least once a year without representatives of the Company management being present.

Guidelines for remuneration of senior executives

The 2016 Annual General Meeting approved the principles for the remuneration of senior executives. The principles for the remuneration of AAK's senior executives are designed to ensure, from an international perspective, that AAK can offer compensation that is competitive and at the prevailing market level to attract DQGUHWDLQTXDOL¿HGSHRSOH7KHWRWDOUHPXQHUDWLRQSDFNDJHSDLG WRVHQLRUH[HFXWLYHVVKDOOFRQVLVWRI¿[HGEDVLFVDODU\DQQXDO variable salary, pension, company car and severance payment. 7KH¿[HGVDODU\VKDOOEHLQGLYLGXDOO\GLIIHUHQWLDWHGRQWKHEDVLV of responsi bility and performance, and shall be set on market principles and revised annually. In addition to annual salary, senior executives shall also receive a variable salary, which shall have a pre-set ceiling and be based on the outcome in relation to goals set annually. The goals shall be related to the company's performance and shall also be able to be linked to individual areas of responsibility. The annual variable portion must not exceed 110 percent RIWKH¿[HGVDODU\,QDGGLWLRQWRWKHYDULDEOHVDODU\PHQWLRQHG share or share-price related incentive programs may be added as determined from time to time by the Annual General Meeting. The right to a pension for senior executives shall apply from the age of 60 at the earliest. Pension plans for senior executives shall be HLWKHUGH¿QHGEHQH¿WRUGH¿QHGFRQWULEXWLRQSODQVRUDFRPELQDtion of the two. In the event of termination of employment by the Company, the notice period for the President and other senior executives shall be twelve months, and they shall be entitled to receive severance pay with a pre-determined ceiling corresponding to twelve months' salary. For termination of employment by the employee, a notice period of six months shall normally apply and no severance pay shall be payable. These guidelines will cover those persons who are in Group management positions during the period of time in which the guidelines apply. The guidelines apply to agreements entered into after a resolution by the Annual General Meeting, and in the event that changes are made to existing agreements after this point in time. The Board will be entitled to diverge from the guidelines if there are particular reasons to do so in an individual case.

Board committees

Audit and remuneration issues within the Board are handled in committees, whose task it is to prepare issues arising and submit proposals for decisions to the Board. The tasks and working practices of the committees are determined by the Board in written instructions, which constitute part of the Board's working practices.

Remuneration Committee

In accordance with the Board's working practices, issues of remu-QHUDWLRQWRWKH&KLHI([HFXWLYH2I¿FHUDQGVHQLRUH[HFXWLYHVVKDOO be prepared by the Remuneration Committee. The Remuneration Committee prepares and presents proposals to the Board relating to remuneration to the President and other senior executives. 7KH¿QDOWDVNRIWKH5HPXQHUDWLRQ&RPPLWWHHLVWRPRQLWRUDQG evaluate the ongoing programs for variable remuneration of the company management team, and programs terminated during the year, as well the application of the guidelines for the remuneration of senior executives and the current remuneration structure and remuneration levels in the company. During 2016, the members of the Remuneration Committee were Melker Schörling (Chairman)

and Ulrik Svensson. The recommendations of the Remuneration Committee to the Board include principles for remuneration, the UHODWLRQVKLSEHWZHHQ¿[HGDQGYDULDEOHVDODU\FRQGLWLRQVIRU SHQVLRQVDQGVHYHUDQFHSD\DQGRWKHUEHQH¿WVSD\DEOHWRWKH management. Remuneration to the CEO of the Group has been decided by the Board on the basis of the recommendations of the Remuneration Committee. Remuneration to other senior execu-WLYHVKDVEHHQGHFLGHGE\WKH&KLHI([HFXWLYH2I¿FHULQ consultation with the Remuneration Committee. For further information, see page 64. During 2016, the Remuneration Committee met on one occasion, on which both members attended. The Board's proposal for guidelines for remuneration to senior executives can be found in Note 8, and will be put to the Annual General Meeting in 2017 for a decision.

Audit Committee

During 2016, the members of the Audit Committee were Ulrik Svensson (Chairman), Märta Schörling Andreen and Lillie Li Valeur. The Committee held four ordinary meetings and one extraordinary meeting during the year, which the company's external auditors and representatives of the management team attended. Areas dealt with by the Audit Committee primarily related to planning, scope and follow-up of the audit for the year. Other issues dealt with include risk management, integration and systematics of Group procedures, coordination of insurance issues, corporate governance, internal control, accounting rules, development of the JOREDO¿QDQFHIXQFWLRQ¿QDQFLQJRSHUDWLRQVDQGRWKHULVVXHVWKDW the Board has requested the Committee to prepare. Under the provisions of Chap. 8, Section 49 a, of the Swedish Companies Act (2005:551), at least one member of the Audit Committee must be LQGHSHQGHQWLQUHODWLRQWRPDMRUVKDUHKROGHUVLQWKH&RPSDQ\DQG KDYHH[SHUWLVHLQDFFRXQWLQJRUDXGLWLQJDQGWKH&RPSDQ\IXO¿OV this requirement of the Code.

External auditors

AAK's auditors are appointed by the Annual General Meeting. At the Annual General Meeting in 2016, the audit company PricewaterhouseCoopers AB was re-elected as auditors up WRDQGLQFOXGLQJWKH\$QQXDO*HQHUDO0HHWLQJLQ6R¿D Götmar-Blomstedt, Authorized Public Accountant, was appointed DXGLWRULQFKDUJH6R¿D*|WPDU%ORPVWHGWDOVRKDVDXGLWLQJWDVNV in companies including Coop Sverige, Oatly, Genovis AB, Pågengruppen AB and Polykemi AB. All services requested in addition to the statutory audit are tested separately to ensure there is no FRQÀLFWDULVLQJLQYROYLQJLQGHSHQGHQFHRUGLVTXDOL¿FDWLRQ1R agreements with related parties exist.

Operational management

It is the task of the CEO to lead operations in accordance with WKHJXLGHOLQHVDQGLQVWUXFWLRQVRIWKH%RDUG,QFRQMXQFWLRQZLWK this, the CEO shall use the required control systems to ensure the company complies with applicable laws and ordinances. The CEO reports to the Board meetings and shall ensure the Board receives as much factual, detailed and relevant information as is required for the Board to reach well-informed decisions. The CEO also maintains continual dialogue with the Chairman of the Board and NHHSVKLPLQIRUPHGRIWKHGHYHORSPHQWDQG¿QDQFLDOSRVLWLRQRI the Company and the Group.

AAK's Group management team consists of thirteen persons from six countries: the CEO, CFO, CMO, CTO and President European Supply Chain, as well as eight persons in charge of EXVLQHVVDUHDVFRXQWULHVRQHRIZKRPLVDOVRWKH+5RI¿FHU The Group management team meets on a monthly basis and GHDOVZLWKWKH*URXS¶V¿QDQFLDOGHYHORSPHQWLQYHVWPHQWV V\QHUJ\DQGSURGXFWLYLW\SURMHFWVDFTXLVLWLRQV*URXSZLGH

GHYHORSPHQWSURMHFWVOHDGHUVKLSDQGFRPSHWHQFHVXSSO\DQG other strategic issues. The meetings are chaired by the CEO, who reaches decisions in consultation with the other members of the Group management team. The Group has a small number of Group employees, who are responsible for Group-wide activities, VXFKDV¿QDQFLDOSHUIRUPDQFHWD[,7LQWHUQDODXGLWVWUDWHJ\ investor relations, information and legal issues. The CEO and Group management team are presented on pages 30–31. For remuneration principles and salaries and other fees paid to the CEO and Group management team, please see Note 8.

AAK's business areas are Food Ingredients, Chocolate & Confectionery Fats and Technical Products & Feed. The heads of each business area/country are responsible for goals, strategies, product development and day-to-day business issues, as well as IRUSUR¿WFDVKÀRZDQGEDODQFHVKHHWVIRUWKHXQLWLQTXHVWLRQ The business areas in turn are organized into different sectors with responsibility for day-to-day business issues. Direction is exercised through internal boards, which meet four times a year. At these meetings, AAK's President/CEO acts as Chairman of the Board, and the Group CFO also participates. Other executives are co-opted as necessary. In all countries where AAK has subsidiaries, a Country Manager has legal charge of operations. The Country Manager's task is to represent AAK vis-à-vis public authorities in the country, to coordinate operations on the ground, RUJDQL]DWLRQDQG*URXSZLGHSURFHGXUHVSURMHFWVDQGWRHQVXUH that Group-wide guidelines are complied with. For each such country, one member of the Group management team has been appointed to have overriding responsibility for operations. This person is the superior of the Country Manager, and in most cases acts as chairman of the local legal board.

The Board's description of internal control and risk PDQDJHPHQWUHODWLQJWR¿QDQFLDOUHSRUWLQJ

The Board is responsible for AAK's internal control, the overall purpose of which is to protect the owners' investments and the Company's assets. The Board shall provide a description of how LQWHUQDOFRQWURODQGULVNPDQDJHPHQWUHODWLQJWR¿QDQFLDOUHSRUWLQJ are organized in a separate section of this Corporate Governance 5HSRUW,QWHUQDOFRQWUROUHODWLQJWR¿QDQFLDOUHSRUWLQJLVDSURFHVV involving the Board, the company management team and personnel.

The process has been designed to ensure the reliability of external reporting. According to the commonly accepted framework established for this purpose, internal control is usually described IURP¿YHGLIIHUHQWDVSHFWVZKLFKDUHGHVFULEHGEHORZ7KHFRQWURO environment forms the basis for internal management and control. Risk assessment and risk management mean that the management is aware of and has itself assessed and analyzed risks and threats to operations.

Control activities are the measures and procedures designed by the management to prevent errors from arising and for discovering and correcting errors that do arise. In order for individual tasks to be carried out in a satisfactory manner, the personnel in an organization need to have access to current and relevant informa-WLRQ7KH¿QDOPRGXOHRIWKHPRGHOUHODWHVWRIROORZXSRILQWHUQDO management and the design and effectiveness of controls.

Control environment

AAK's organization is designed to facilitate quick decision-making. Operational decisions are therefore made at business area or subsidiary level, while decisions about strategies, acquisitions and RYHUULGLQJ¿QDQFLDOLVVXHVDUHWDNHQE\WKHFRPSDQ\¶V%RDUGDQG Group management team. The organization is characterized by clear division of responsibilities and effective and established management and control systems, covering all units within AAK.

7KHEDVLVIRUWKHLQWHUQDOFRQWUROUHODWLQJWR¿QDQFLDOUHSRUWLQJ consists of an overall control environment in which the organization, decision-making routes, authorities and responsibilities have been documented and communicated in management documents, VXFKDV\$\$.¶V¿QDQFLDOSROLF\UDZPDWHULDOSXUFKDVLQJSROLF\ WKHPDQXDORQ¿QDQFLDOUHSRUWLQJDQGWKHDXWKRUL]DWLRQUXOHV VHWE\WKH&(2\$\$.¶V¿QDQFHIXQFWLRQVDUHLQWHJUDWHGWKURXJK DMRLQWFRQVROLGDWLRQV\VWHPDQGMRLQWDFFRXQWLQJLQVWUXFWLRQV 7KH*URXS¶V¿QDQFHXQLWZRUNVFORVHO\DQGHIIHFWLYHO\ZLWKWKH FRQWUROOHUVRIVXEVLGLDULHVLQUHODWLRQWR\HDUHQG¿QDQFLDOVWDWHments and reporting.

\$VDVXSSOHPHQWWRWKHLQWHUQDOFRQWUROXQGHUDVSHFL¿FSODQDQ annual audit of some units in the Group is carried out on a rotating basis by the Group's central Finance Department, in collabora-WLRQZLWKDQLQGHSHQGHQWLQWHUQDWLRQDODFFRXQWLQJ¿UP\$\$.KDV decided not to set up a separate review function (internal audit), DVWKHIXQFWLRQVPHQWLRQHGDERYHIXO¿OWKLVWDVNZHOO\$OORI\$\$.¶V subsidiaries report on a monthly basis. These reports form the EDVLVIRUWKH*URXS¶VFRQVROLGDWHG¿QDQFLDOUHSRUWLQJ(DFKOHJDO XQLWKDVDFRQWUROOHUZKRLVUHVSRQVLEOHIRUWKH¿QDQFLDOPDQDJH-PHQWRIHDFKEXVLQHVVDUHDDQGIRUHQVXULQJWKH¿QDQFLDOUHSRUWV are correct, complete and delivered in time for consolidated reporting.

5LVNDVVHVVPHQWDQGULVNPDQDJHPHQW

Through its international presence, the AAK Group is exposed to a number of different risks. Risk management within the Group is UXQLQDFFRUGDQFHZLWK¿[HGSROLFLHVDQGSURFHGXUHVZKLFKDUH reviewed annually by AAK's Board. Risks relating to commodities are managed using the Group's raw material purchasing policy. Risks relating to currency, interest and liquidity are mainly JRYHUQHGE\$\$.¶V¿QDQFHSROLF\7KH*URXS¶VFUHGLWSROLF\ directs the management of credit and contract risks. Effective risk management unites operational business development with the requirements of owners and other stakeholders for improvements in control and long-term value. Risk management aims to minimize risks, but also to ensure that opportunities are utilized in the best possible way. Risk management covers the following areas of risk: strategic risks relating to the market and sector, commercial, RSHUDWLRQDODQG¿QDQFLDOULVNVFRPSOLDQFHZLWKH[WHUQDODQG LQWHUQDOUHJXODWRU\IUDPHZRUNVDQG¿QDQFLDOUHSRUWLQJ7KHPDLQ FRPSRQHQWVRIULVNDVVHVVPHQWDQGPDQDJHPHQWDUHLGHQWL¿FDtion, evaluation, management, reporting, follow-up and control. For further information about AAK's risk management, please see Note 3.

&RQWURODFWLYLWLHV

7KHULVNVLGHQWL¿HGUHODWLQJWR¿QDQFLDOUHSRUWLQJDUHKDQGOHGYLD the company's control activities. These control activities aim to prevent, identify and correct errors and discrepancies. Control activities take the form of manual controls, such as reconciliation and stocktaking, automatic controls via the IT systems and general controls of the underlying IT environment. Detailed ¿QDQFLDODQDO\VHVRIWKHUHVXOWDQGIROORZXSDJDLQVWEXGJHWVDQG IRUHFDVWVVXSSOHPHQWWKHRSHUDWLRQVSHFL¿FFRQWUROVDQGSURYLGH RYHUDOOFRQ¿UPDWLRQRIWKHTXDOLW\RIWKHUHSRUWLQJ

,QIRUPDWLRQDQGFRPPXQLFDWLRQ

7RHQVXUHWKHFRPSOHWHQHVVDQGDFFXUDF\RILWV¿QDQFLDOUHSRUWLQJ the Group has adopted guidelines for information and commu-QLFDWLRQDLPHGDWHQVXULQJUHOHYDQWDQGVLJQL¿FDQWH[FKDQJHRI information within business operations, both within each unit and to and from management and the Board. Policies, handbooks and ZRUNLQJSUDFWLFHVUHODWLQJWRWKH¿QDQFLDOSURFHVVDUHFRPPXQLcated between the management and employees, and are available in electronic format and/or printed format. The Board receives regular feedback on internal control from the Audit Committee. To ensure that external information is correct and complete, AAK has an information policy adopted by the Board, which states what is to be communicated, by whom and in what way.

)ROORZXS

The effectiveness of the process for risk assessment and execution of control activities is followed up continuously. The follow-up covers both formal and informal procedures, which are used by those responsible at each level. The procedures include follow-up RIUHVXOWVDJDLQVWEXGJHWVDQGSODQVDQDO\VHVDQGNH\¿JXUHV 7KH%RDUGUHFHLYHVPRQWKO\UHSRUWVDERXWWKH*URXS¶V¿QDQFLDO SRVLWLRQDQGGHYHORSPHQW7KHFRPSDQ\¶V¿QDQFLDOVLWXDWLRQLV discussed at each Board meeting, and the management team DQDO\VHVWKH¿QDQFLDOUHSRUWLQJDWGHWDLOHGOHYHORQDPRQWKO\ basis.

At Audit Committee meetings, the Committee follows up the ¿QDQFLDOUHSRUWLQJDQGUHFHLYHVUHSRUWVIURPWKHDXGLWRUVDERXW their observations.

3ROLF\GRFXPHQWV

AAK has a number of policies for the operations of the Group and its employees. These include:

Ethics policy

Ethical guidelines for the Group have been drawn up with the aim of clarifying the Group's fundamental approach to ethical issues, both within the Group and externally with regard to customers and suppliers.

Finance policy

7KH*URXS¶V¿QDQFHIXQFWLRQZRUNVLQDFFRUGDQFHZLWKLQVWUXFtions adopted by the Board, which provide a framework for how the *URXS¶VRSHUDWLRQVVKDOOEH¿QDQFHGDQGIRUKRZIRUH[DPSOH currency and interest risks are to be handled.

Information policy

The Group's information policy is a document describing the Group's general principles for the publication of information.

Environmental policy

The Group's environmental policy provides guidelines for environmental work within the Group.

Melker Schörling Arne Frank Märta Schörling Andreen Marianne Kirkegaard Chairman of the Board Chief Executive Officer and President

Member Member

Lillie Li Valeur Leif Håkansson Annika Westerlund Member Employee representative Employee representative

Audited and submitted on March 31, 2017 PricewaterhouseCoopers AB

Sofia Götmar-Blomstedt Authorized public accountant Auditor in charge

The consolidated income statement and balance sheet will be presented to the Annual General Meeting on May 17, 2017 for adoption.

7KH%RDUGRI'LUHFWRUVDQGWKH&KLHI([HFXWLYH2I¿FHUGHFODUH that the consolidated accounts have been prepared in accor dance with IFRS International Accounting Standards, as adopted by WKH(8DQGSURYLGHDWUXHDQGIDLUYLHZRIWKH*URXS¶V¿QDQFLDO position and results. The annual accounts have been prepared in accordance with generally accepted accounting practices and SURYLGHDWUXHDQGIDLUYLHZRIWKH3DUHQW¶V¿QDQFLDOSRVLWLRQDQG results.

The Directors' Report for the Group and Parent provides a true and IDLUYLHZRIWKHGHYHORSPHQWRIWKHEXVLQHVVRSHUDWLRQV¿QDQFLDO position and results of the Group and Parent and describes the VLJQL¿FDQWULVNVDQGXQFHUWDLQW\IDFWRUVIDFLQJWKH3DUHQWDQGWKH companies belonging to the Group.

0DOP|0DUFK

2SLQLRQV

We have audited the annual accounts and consolidated accounts of AAK AB (publ.) for the year 2016 except for the corporate governance statement on pages 79–83. The annual accounts and consolidated accounts of the company are included on pages 37–84, in this document.

In our opinion, the annual accounts have been prepared in accordance with the Annual Accounts Act and present fairly, in all material respects, the financial position of parent company as of December 31, 2016 and its financial performance and cash flow for the year then ended in accordance with the Annual Accounts Act. The consolidated accounts have been prepared in accordance with the Annual Accounts Act and present fairly, in all material respects, the financial position of the group as of December 31, 2016 and their financial performance and cash flow for the year then ended in accordance with International Financial Reporting Standards (IFRS), as adopted by the EU, and the Annual Accounts Act. Our opinions do not cover the corporate governance statement on pages 79–83.

The statutory administration report is consistent with the other parts of the annual accounts and consolidated accounts.

We therefore recommend that the general meeting of shareholders adopts the income statement and balance sheet for the parent company and the group.

%DVLVIRU2SLQLRQV

We conducted our audit in accordance with International Standards on Auditing (ISA) and generally accepted auditing standards in Sweden. Our responsibilities under those standards are further described in the Auditor's Responsibility section. We are independent of the parent company and the group in accordance with professional ethics for accountants in Sweden and have otherwise fulfilled our ethical responsibilities in accordance with these requirements.

We believe that the audit evidence we have obtained is sufficient and appropriate to provide a basis for our opinions.

2XUDXGLWDSSURDFK

Audit scope

We designed our audit by determining materiality and assessing the risks of material misstatement in the annual accounts and consolidated

Auditor's report

To the general meeting of the shareholders of AAK AB (publ.), corporate identity number 556669-2850

Report on the annual accounts and consolidated accounts

accounts. In particular, we considered where management made sub-MHFWLYHMXGJHPHQWVIRUH[DPSOHLQUHVSHFWRIVLJQLILFDQWDFFRXQWLQJHVWLmates that involved making assumptions and considering future events that are inherently uncertain. As in all of our audits, we also addressed the risk of management override of internal controls, including among other matters consideration of whether there was evidence of bias that represented a risk of material misstatement due to fraud.

We tailored the scope of our audit in order to perform sufficient work to enable us to provide an opinion on the annual accounts and consolidated accounts as a whole, taking into account the structure of the Group, the accounting processes and controls, and the industry in which the group operates.

*0DWHULDOLW*

The scope of our audit was influenced by our application of materiality. An audit is designed to obtain reasonable assurance whether the annual accounts and consolidated accounts are free from material misstatement. Misstatements may arise due to fraud or error. They are considered material if individually or in aggregate, they could reasonably be expected to influence the economic decisions of users taken on the basis of the annual accounts and consolidated accounts.

%DVHGRQRXUSURIHVVLRQDOMXGJHPHQWZHGHWHUPLQHGFHUWDLQTXDQWLtative thresholds for materiality, including the overall materiality for the annual accounts and consolidated accounts as a whole. These, together with qualitative considerations, helped us to determine the scope of our audit and the nature, timing and extent of our audit procedures and to evaluate the effect of misstatements, both individually and in aggregate on the annual accounts and consolidated accounts as a whole.

.H\DXGLWPDWWHUV

Key audit matters of the audit are those matters that, in our professional MXGJPHQWZHUHPRVWVLJQLILFDQWLQRXUDXGLWRIWKHDQQXDODFFRXQWV and consolidated accounts of the current period. These matters were addressed in our audit of, and in forming our opinion thereon, the annual accounts and consolidated accounts as a whole, but we do not provide a separate opinion on these matters.

.H\DXGLWPDWWHU +RZRXUDXGLWDGGUHVVHGWKH.H\DXGLWPDWWHU

Revenue recognition

– accounting of entered sales contracts

7KHDFFRXQWLQJRIUHYHQXHVFRPSULVHVDVLJQL¿FDQWULVNEDVHGRQ WKHLULPSRUWDQFHLQWKH¿QDQFLDOLQIRUPDWLRQDQGWKHFRPSOH[LW\LQ the valuation of entered sales contracts.

As seen on page 22 and Note 3 of the annual report, AAK applies active risk management. The value of the sales contracts entered, are reported in accordance with IAS 39 which implies that all of these are valued and reported at market value as at balance sheet date.

The market value is determined, as appropriate, on the basis of liquid market prices in an open market and on stock exchange prices. Any possible error in the applied market price has a direct impact on the reported revenues and results.

Any possible omission in the reporting of entered contracts, or WKHULVNRI¿FWLWLRXVDJUHHPHQWVEHLQJUHSRUWHGZRXOGLPSO\DQ impact on reported revenues and would limit AAK's possibility to achieve appropriate risk management measures.

In order to verify that revenues are complete, correctly reported and valued, and that they comprise of existing sales contracts, our audit has included, amongst other things, a combination of :

  • a review and testing of AAK's internal controls

  • tests of detail through, amongst other measures, random sampling

  • analytical procedures, amongst other things, with the help of data analyses

The audit activities described above refer to the sales process in its entirety (registration of sales contracts, delivery to the customer, inventory transactions, invoicing, receipt of payments and valuation).

In order to ensure the completeness and correctness of the reporting regarding signed contracts, we have, amongst other things:

  • created an understanding for, and tested, the controls intended to identify un-allowed activities linked to the signing and valuation of sales contracts, - tested confirmations from counterparties regarding established sales contracts.

No deviations have been noted in the reporting of established sales contracts based on the executed audit, as described above.

Acquisition

As seen on page 38 and in Note 27, in the annual report, AAK acquired California Oils in the US during the year. After allocation of the purchase price, the acquisition resulted in negative goodwill of MSEK 135 which, in accordance with the regulations in effect, was reported in income. At the same time, AAK has provided for future integration costs, the net of which has positively impacted results in an amount of MSEK 15.

The work with identifying and ensuring the completeness and YDOXDWLRQRIVHSDUDWHO\LGHQWL¿DEOHDVVHWVDQGOLDELOLWLHVLVFRPSOH[ DQGLQFOXGHVMXGJPHQWV\$QHUURUHLWKHULQLGHQWLI\LQJRUYDOXLQJ WKHVHLWHPVFDQOHDGWRDQLQFRUUHFWFODVVL¿FDWLRQLQWKHEDODQFH sheet at point of acquisition and also, later, in the income statement.

We have received copies of and studied and understood the management's assessment of the value of the acquired assets and liabilities, and of their nature. We have evaluated the management's assumptions based on the group's accounting policy by, amongst other things:

  • reading agreements, decision-making documentation, due diligence reports and audited financial reports,
  • through, amongst other things, meetings with specialists and visits to the SODQWDW&DOLIRUQLD2LOVDQLQGHSHQGHQFHHYDOXDWLRQWKHREMHFWLYLW\DQG competence of the specialists contracted by management to assist them in the valuation process with the aim of ensuring that they are qualified and have adequate industry knowledge,
  • through utilizing our internal valuation specialists to independently evaluate the models and assumptions applied by management in identifying and valuing assets and liabilities.
  • assessed the economic useful lives of the assets and ensured that these agree with our understanding of the acquired assets and of the group's accounting principles.

6LJQL¿FDQWDVVXPSWLRQVPDGHE\WKHPDQDJHPHQWKDYHEHHQGHHPHG to be supported and to be correct against the background of current and known circumstances.

Valuation of purchase contracts regarding raw materials and inventory on hand

AAK has a purchase process implying that as soon as a sales contract has been signed, the equivalent currency and raw material price is hedged.

The active risk management applied by AAK is described on page 22 and in Note 3 in the annual report. Entered purchase contracts (physical contracts and derivative instruments), including inventory on hand, are reported according to IAS 39, which implies that all of these items are valued and reported at market value as at balance sheet date.

7KHUHSRUWLQJRIUDZPDWHULDOVSXUFKDVHVLVFRPSOH[DQGÀXF-WXDWLRQVLQUDZPDWHULDOVSULFHVFDQKDYHDVLJQL¿FDQWLPSDFWRQ WKH¿QDQFLDOLQIRUPDWLRQZKLFKLVWKHUHDVRQDQLQFRUUHFWYDOXDWLRQ of purchase contracts and inventories can have a direct impact on costs and results.

A possible omission in reporting entered contracts or the risk WKDWD¿FWLYHFRQWUDFWLVUHSRUWHGZRXOGLPSO\DQLPSDFWRQ reported costs and would limit AAK's possibilities to achieve an appropriate risk management.

In order to verify that raw material costs are complete, correctly reported and valued, and that they are comprised of existing purchase contracts, our audit has included, amongst other things:

  • a review and testing of AAK's internal controls regarding the updating and registration of market prices,

  • data analyses, tests of detail through random sampling and other analytical procedures in order to ensure the registration of signed contracts, received deliveries, inventory transactions, received invoices, payments and registered market prices.

In order to ensure the completeness and correctness of the accounts regarding signed purchase contracts, we have, amongst other things:

  • obtained an understanding of, and tested, the controls referring to the identification of un-allowed activities associated with the subscription and

  • valuation of purchase contracts, - tested the confirmations received from counter parties regarding estab-

  • lished purchase contracts.

No deviations have been noted based on the audit activities described above.

Other information than the annual accounts and consolidated accounts

This document also contains other information than the annual accounts and consolidated accounts and is found on pages 79–83. The Board of Directors and the Managing Director are responsible for this other information.

Our opinion on the annual accounts and consolidated accounts does not cover this other information and we do not express any form of assurance conclusion regarding this other information.

In connection with our audit of the annual accounts and consolidated accounts, our responsibility is to read the information identified above and consider whether the information is materially inconsistent with the annual accounts and consolidated accounts. In this procedure we also take into account our knowledge otherwise obtained in the audit and assess whether the information otherwise appears to be materially misstated.

If we, based on the work performed concerning this information, conclude that there is a material misstatement of this other information, we are required to report that fact. We have nothing to report in this regard.

Responsibilities of the Board of Directors and the Managing Director

The Board of Directors and the Managing Director are responsible for the preparation of the annual accounts and consolidated accounts and that they give a fair presentation in accordance with the Annual Accounts Act and, concerning the consolidated accounts, in accordance with IFRS as adopted by the EU. The Board of Directors and the Managing Director are also responsible for such internal control as they determine is necessary to enable the preparation of annual accounts and consolidated accounts that are free from material misstatement, whether due to fraud or error.

In preparing the annual accounts and consolidated accounts, The Board of Directors and the Managing Director are responsible for the assessment of the company's and the group's ability to continue as a going concern. They disclose, as applicable, matters related to going concern and using the going concern basis of accounting. The going concern basis of accounting is however not applied if the Board of Directors and the Managing Director intend to liquidate the company, to cease operations, or have no realistic alternative but to do so.

7KH\$XGLW&RPPLWWHHVKDOOZLWKRXWSUHMXGLFHWRWKH%RDUGRI'LUHFWRU¶V responsibilities and tasks in general, among other things oversee the company's financial reporting process.

Auditor's responsibility

2XUREMHFWLYHVDUHWRREWDLQUHDVRQDEOHDVVXUDQFHDERXWZKHWKHUWKH annual accounts and consolidated accounts as a whole are free from material misstatement, whether due to fraud or error, and to issue an auditor's report that includes our opinions. Reasonable assurance is a high level of assurance, but is not a guarantee that an audit conducted in accordance with ISAs and generally accepted auditing standards in Sweden will always detect a material misstatement when it exists. Misstatements can arise from fraud or error and are considered material if, individually or in the aggregate, they could reasonably be expected to influence the economic decisions of users taken on the basis of these annual accounts and consolidated accounts.

A further description of our responsibility for the audit of the annual accounts and consolidated accounts is available on Revisorsnämnden's website: www.revisorsinspektionen.se/rn/showdocument/documents/ rev_dok/revisors_ansvar.pdf. This description is part of the auditor´s report.

Report on other legal and regulatory requirements Opinions

In addition to our audit of the annual accounts and consolidated accounts, we have also audited the administration of the Board of Directors and the Managing Director of AAK AB (publ.) for the year 2016 and the proposed appropriations of the company's profit or loss.

We recommend to the general meeting of shareholders that the profit be appropriated in accordance with the proposal in the statutory administration report and that the members of the Board of Directors and the Managing Director be discharged from liability for the financial year.

Basis for Opinions

We conducted the audit in accordance with generally accepted auditing standards in Sweden. Our responsibilities under those standards are further described in the Auditor's Responsibility section. We are independent of the parent company and the group in accordance with professional ethics for accountants in Sweden and have otherwise fulfilled our ethical responsibilities in accordance with these requirements.

We believe that the audit evidence we have obtained is sufficient and appropriate to provide a basis for our opinions.

Responsibilities of the Board of Directors and the Managing Director

The Board of Directors is responsible for the proposal for appropriations of the company's profit or loss. At the proposal of a dividend, this LQFOXGHVDQDVVHVVPHQWRIZKHWKHUWKHGLYLGHQGLVMXVWLILDEOHFRQVLGering the requirements which the company's and the group's type of operations, size and risks place on the size of the parent company's and the group's equity, consolidation requirements, liquidity and position in general.

The Board of Directors is responsible for the company's organization and the administration of the company's affairs. This includes among other things continuous assessment of the company's and the group's financial situation and ensuring that the company's organization is designed so that the accounting, management of assets and the company's financial affairs otherwise are controlled in a reassuring manner. The Managing Director shall manage the ongoing administration according to the Board of Directors' guidelines and instructions and among other matters take measures that are necessary to fulfil the company's accounting in accordance with law and handle the management of assets in a reassuring manner.

Auditor's responsibility

2XUREMHFWLYHFRQFHUQLQJWKHDXGLWRIWKHDGPLQLVWUDWLRQDQGWKHUHE\ our opinion about discharge from liability, is to obtain audit evidence to assess with a reasonable degree of assurance whether any member of the Board of Directors or the Managing Director in any material respect:

  • has undertaken any action or been guilty of any omission which can give rise to liability to the company, or
  • in any other way has acted in contravention of the Companies Act, the Annual Accounts Act or the Articles of Association.

2XUREMHFWLYHFRQFHUQLQJWKHDXGLWRIWKHSURSRVHGDSSURSULDWLRQVRIWKH company's profit or loss, and thereby our opinion about this, is to assess with reasonable degree of assurance whether the proposal is in accordance with the Companies Act.

Reasonable assurance is a high level of assurance, but is not a guarantee that an audit conducted in accordance with generally accepted auditing standards in Sweden will always detect actions or omissions that can give rise to liability to the company, or that the proposed appropriations of the company's profit or loss are not in accordance with the Companies Act.

A further description of our responsibility for the audit of the administration is available on Revisorsnämnden's website: www.revisorsinspektionen.se/rn/showdocument/documents/rev_dok/revisors_ansvar.pdf. This description is part of the auditor´s report.

The auditor's examination of the corporate governance statement The Board of Directors is responsible for that the corporate governance statement on pages 79–83 has been prepared in accordance with the Annual Accounts Act.

Our examination of the corporate governance statement is conducted in accordance with FAR's auditing standard RevU 16 The auditor's examination of the corporate governance statement. This means that our examination of the corporate governance statement is different and substantially less in scope than an audit conducted in accordance with International Standards on Auditing and generally accepted auditing standards in Sweden. We believe that the examination has provided us with sufficient basis for our opinions.

A corporate governance statement has been prepared. Disclosures in accordance with chapter 6 section 6 the second paragraph points 2-6 of the Annual Accounts Act and chapter 7 section 31 the second paragraph the same law are consistent with the other parts of the annual accounts and consolidated accounts and are in accordance with the Annual Accounts Act.

Malmö, March 31, 2017 PricewaterhouseCoopers AB

Sofia Götmar-Blomstedt Authorized public accountant Auditor in charge

The AAK share

AAK's shares have been traded since October 2, 2006 on the NASDAQ OMX, Stockholm, the Nordic List. As from January 2, 2014 AAK shares have been traded in the Large Cap (previously Mid Cap) segment in the Consumer Commodities sector. The abbreviation is AAK and the ISIN code is SE0001493776.

Turnover and price trend

During 2016, 13.4 (13.9) million shares were traded at a total value of SEK 7,959 million (7,345), which corresponds to a turnover rate of 32 percent (33). The average trade per trading day was 53,160 (55,762) shares or SEK 31 million (29). At the yearend, the price was SEK 599.50 (627.50) and AAK's market value was SEK 25,352 million (26,536). The highest price during the year was SEK 650.50 (March 30) and the lowest price was SEK 507.50 (February 8).

Share capital

As at December 31, 2016 the share capital of AAK was SEK 422,884,890 (422,884,890). The number of shares was 42,288,489 (42,288,489). The quota value per share was SEK 10. Each share entitles the holder to one vote. All shares have equal rights to SDUWLFLSDWHLQWKHSUR¿WVDQGDVVHWVRIWKH&RPSDQ\

Ownership

There were 9,641 (9,124) shareholders as at December 31, 2016.

Planned dividend policy

The Board of Directors has adopted a dividend policy. According WRWKHSROLF\WKHREMHFWLYHRIWKH%RDUGRI'LUHFWRUVWDNLQJLQWR DFFRXQWWKHGHYHORSPHQWRI*URXSHDUQLQJVLWV¿QDQFLDOSRVLWLRQ and future development opportunities, is to propose annual divi-GHQGVHTXLYDOHQWWRDWOHDVW±SHUFHQWRIWKHSUR¿WIRUWKH\HDU after tax, for the Group.

Ordinary dividend

7KH%RDUGRI\$\$.SURSRVHVDGLYLGHQGIRUWKH¿QDQFLDO year of SEK 8.75 (7.75) per share, a total of SEK 370 million (328).

AAK's Investor Relations work

AAK's aim is for the shares to be valued on the basis of relevant, accurate and up-to-date information. This requires a clear strategy IRU¿QDQFLDOFRPPXQLFDWLRQUHOLDEOHLQIRUPDWLRQDQGUHJXODU FRQWDFWZLWK¿QDQFLDOPDUNHWVWDNHKROGHUV

&RQWDFWZLWKWKH¿QDQFLDOPDUNHWVWDNHVSODFHYLDSUHVHQWDWLRQV LQFRQMXQFWLRQZLWKTXDUWHUO\UHSRUWVDQGPHHWLQJVZLWKDQDO\VWV LQYHVWRUVDQGMRXUQDOLVWVDWFDSLWDOPDUNHWGD\VVHPLQDUVDQG visits to AAK's divisions.

During 2016, a capital market day was held in Stockholm, and a large number of meetings were held with analysts and other professional operators on site in Frankfurt, Copenhagen, London, New York, Paris and Stockholm.

Those interested can obtain presentation material and listen to audio recordings from quarterly presentations at www.aak.com.

Analysts

ABG Sundal Collier – Casper Blom Berenberg Bank – James Targett Carnegie Investment Bank – Kenneth Toll Johansson Exane BNP Paribas – Heidi Vesterinen Handelsbanken – Karri Rinta Nordea Bank – Carl Mellerby SEB Enskilda – Richard Koch

Financial information about AAK is available at www.aak.com, ZKHUH¿QDQFLDOUHSRUWVSUHVVUHOHDVHVDQGSUHVHQWDWLRQVFDQEH obtained. The Company's press releases are distributed via Cision and are also available on the Company's website.

The Company management can be contacted as follows: Telephone: +46 (0)40 627 83 00 Email: [email protected]

Shareholder contacts

Fredrik Nilsson CFO Telephone: +46 (0)40 627 83 00 Email: [email protected]

Major shareholders, December 30, 2016
No. of
shares
Proportion of
share capital
and votes, %
Melker Schörling AB 13,899,301 32.9
AMF – Försäkring och
Fonder
3,509,668 8.3
Handelsbanken Fonder AB 2,359,687 5.6
Alecta Pensionsförsäkring 2,000,000 4.7
Didner & Gerge Fonder
Aktiebolag
1,733,053 4.1
Swedbank Robur Fonder 1,310,995 3.1
SEB Investment
Management
1,137,345 2.7
NTC Various Fiduciary
Capacit
612,645 1.4
Nordea Investment Funds 505,411 1.2
NTC S/A UK Residents 464,767 1.1
Other shareholders 15,260,523 39.1
Total 42,288,489 100.0

The AAK share September 29, 2005 to December 31, 2016

Source:

'LVWULEXWLRQRIVKDUHKROGLQJV'HFHPEHU ,QIRUPDWLRQSHUVKDUH
3URSRUWLRQ 3URSRUWLRQRI
1RRIVKDUHV 1RRI
VKDUHKROGHUV
RIDOO
VKDUHKROGHUV
VKDUHFDSLWDO
DQGYRWHV
Share price,
± 25 reporting date, SEK 599.50 627.50
Dividend, SEK 8.75 7.75
± 17 Direct yield, % 1.46 1.23
± 37 Earnings per share,
± 15 SEK 23.71 22.17
± 15 Equity per share,
SEK
177.87 156.77
± 10 Share price/Equity 3.37 4.00
± 881
Total 1000 Definitions, see page 90.

'H¿QLWLRQV

3URSRUWLRQRIULVNEHDULQJFDSLWDO (TXLW\QRQFRQWUROOLQJVKDUHRIHTXLW\DQGGHIHUUHGWD[OLDELOLW\ GLYLGHGE\EDODQFHVKHHWWRWDO

*5HWXUQRQVKDUHKROGHUV¶HTXLW* 3UR¿WORVVIRUWKH\HDUDVDSHUFHQWDJHRIDYHUDJHVKDUHKROGHUV¶ HTXLW\

5HWXUQRQRSHUDWLQJFDSLWDO 2SHUDWLQJSUR¿WGLYLGHGE\DYHUDJHRSHUDWLQJFDSLWDO

*URVVFRQWULEXWLRQ 2SHUDWLQJLQFRPHPLQXVFRVWRIJRRGV

*6KDUHSULFH(TXLW* 6KDUHSULFHGLYLGHGE\HTXLW\SHUVKDUH

'LUHFW\LHOG 'LYLGHQGSHUVKDUHDVDSHUFHQWDJHRIWKHVKDUHSULFH

(TXLW\SHUVKDUH (TXLW\GLYLGHGE\DYHUDJHQXPEHURIVKDUHVDWWKHEDODQFHVKHHW GDWH

&DSLWDOWXUQRYHUUDWH 1HWVDOHVGLYLGHGE\DYHUDJHRSHUDWLQJFDSLWDO

&DVKDQGFDVKHTXLYDOHQWV &DVKDQGEDQNEDODQFHVSOXVVKRUWWHUPLQYHVWPHQWVZLWKD PDWXULW\RIOHVVWKDQWKUHHPRQWKV

(DUQLQJVSHUVKDUH 3UR¿WORVVIRUWKH\HDUGLYLGHGE\WKHDYHUDJHQXPEHURIVKDUHVRQ WKHEDODQFHVKHHWGDWH

1HWERUURZLQJV 7KHWRWDORILQWHUHVWEHDULQJOLDELOLWLHVPLQXVLQWHUHVWEHDULQJ DVVHWV

3(UDWLR 6KDUHSULFHGLYLGHGE\HDUQLQJVSHUVKDUH

,QWHUHVWFRYHUDJHUDWLR 2SHUDWLQJSUR¿WORVVSOXV¿QDQFLDOLQFRPHGLYLGHGE\¿QDQFLDO H[SHQVHV

:RUNLQJFDSLWDO 1RQLQWHUHVWEHDULQJFXUUHQWDVVHWVPLQXVQRQLQWHUHVWEHDULQJ OLDELOLWLHVH[FOXGLQJGHIHUUHGWD[

1HWGHEWHTXLW\UDWLR 1HWERUURZLQJVGLYLGHGE\HTXLW\LQFOXGLQJQRQFRQWUROOLQJ LQWHUHVWV

(TXLW\DVVHWVUDWLR (TXLW\LQFOXGLQJQRQFRQWUROOLQJLQWHUHVWVDVDSHUFHQWDJHRIEDO DQFHVKHHWWRWDO

2SHUDWLQJFDSLWDO

7RWDODVVHWVPLQXVFDVKDQGFDVKHTXLYDOHQWVLQWHUHVWEHDULQJ UHFHLYDEOHVDQGQRQLQWHUHVWEHDULQJRSHUDWLQJOLDELOLWLHVEXW H[FOXGLQJGHIHUUHGWD[

'LYLGHQGSD\RXWUDWLR 'LYLGHQGSHUVKDUHDVDSHUFHQWDJHRIHDUQLQJVSHUVKDUH

Financial Calendar, Annual General Meeting

This document is a translation of the Swedish language version. In the event of any discrepancies between the translation and the original Swedish AAK Annual Report 2016, the latter shall prevail.

Reporting schedule

\$\$.\$%SXEO?ZLOOSURYLGH¿QDQFLDOLQIRUPDWLRQIRUWKH ¿QDQFLDO\HDURQWKHIROORZLQJRFFDVLRQV

  • 7KHLQWHULPUHSRUWIRUWKH¿UVWTXDUWHUZLOOEHSXEOLVKHGRQ April 20.
  • 7KHKDOI\HDUUHSRUWZLOOEHSXEOLVKHGRQ-XO\
  • 7KHLQWHULPUHSRUWIRUWKHWKLUGTXDUWHUZLOOEHSXEOLVKHGRQ October 26.
  • 7KH\HDUHQGUHSRUWIRUZLOOEHSXEOLVKHGRQ February 5, 2018.

Reports and press releases are available in English and Swedish and can be ordered from

AAK AB (publ.) Corporate Communications Skrivaregatan 9 215 32 Malmö, Sweden 7HOHSKRQH? )D[? (PDLOFRPP#DDNFRP

More information on AAK AB (publ.) is available on the Company's ZHEVLWHZZZDDNFRP

Annual General Meeting

AAK AB (publ.)'s Annual General Meeting will take place on :HGQHVGD\0D\DWSPDW0DOP|\$UHQD+\OOLH Stationstorg 2, in Malmö. Doors to the Annual General Meeting open at 1 p.m. and registration must be completed before 2 p.m., at which time the voting list will be established.

Right to attend the Annual General Meeting

Shareholders are entitled to attend the Annual General Meeting if they are registered in the printout of the shareholders' register FUHDWHGRQ:HGQHVGD\0D\DQGLIWKH\KDYHJLYHQQRWLFH WKDWWKH\ZLOODWWHQGWKH\$QQXDO*HQHUDO0HHWLQJE\SPRQ :HGQHVGD\0D\

Registration in the shareholders' register

The company is a reconciliation company and its shares are DI¿OLDWHGZLWK(XURFOHDU6ZHGHQ\$%WKH6ZHGLVKFHQWUDOVHFXULties depository. This means that, in order to be entitled to attend the Annual General Meeting, shareholders must be entered in the shareholders' register held by Euroclear Sweden AB as per

:HGQHVGD\0D\$Q\RQHZKRKDVKDGVKDUHVUHJLVWHUHG through a nominee must temporarily register the shares in their own name to be able to attend the Annual General Meeting. This should be done in good time before this date.

1RWL¿FDWLRQ

Shareholders who wish to attend the Annual General Meeting must QRWLI\WKH&RPSDQ\E\RQHRIWKHIROORZLQJDOWHUQDWLYHV

  • E\SRVWWR AAK AB Annual General Meeting C/o Euroclear Sweden AB Box 191 101 23 Stockholm, Sweden
  • E\WHOHSKRQH? or via the website at www.aak.com as soon as possible and no ODWHUWKDQSPRQ:HGQHVGD\0D\

,QWKHQRWL¿FDWLRQWKHVKDUHKROGHUPXVWVSHFLI\KLVRUKHUQDPH address, phone number, personal or corporate identity number and shareholding. For shareholders who are represented by proxies, WKHRULJLQDOSUR[\IRUPPXVWEHVHQWZLWKWKHQRWL¿FDWLRQ\$Q\RQH UHSUHVHQWLQJDOHJDOHQWLW\PXVWVKRZDFRS\RIWKHFHUWL¿FDWHRI LQFRUSRUDWLRQRUHTXLYDOHQWDXWKRULVDWLRQGRFXPHQWVVKRZLQJWKH\ are an authorized signatory.

1RWLFHRI\$QQXDO*HQHUDO0HHWLQJ

Notice of the Annual General Meeting is published in Post- och Inrikes Tidningar and on the Company's website, including a full agenda. An advertisement regarding the Annual General Meeting being convened will be published in Svenska Dagbladet.

Address

AAK AB (publ.) Skrivaregatan 9 215 32 Malmö, Sweden 7HOHSKRQH? )D[? (PDLOLQIR#DDNFRP www.aak.com Corporate identity no. 556669-2850

For further information, please visit our website at www.aak.com

AAK is a leading provider of value-adding vegetable oils & fats. Our expertise in lipid technology within foods and special nutrition applications, our wide range of raw materials and our broad process capabilities enable us to develop innovative and value-adding solutions across many industries – Chocolate & Confectionery, Bakery, Dairy, Special Nutrition, Foodservice, Personal Care, and more.

AAK's proven expertise is based on more than 140 years of experience within oils & fats. Our unique co-development approach brings our customers' skills and know-how together with our own capabilities and mindset for lasting results.

Listed on the NASDAQ OMX Stockholm and with our headquarters in Malmö, Sweden, AAK has 20 different production facilities, sales RI¿FHVLQPRUHWKDQFRXQWULHVDQGQHDUO\HPSOR\HHV

We are AAK – The Co-Development Company.

We are AAK

([SORUHPRUHDW ZZZDDNFRP